Cyclopterus lumpus (lumpfish): 117735638 Help Entry 117735638         CDS       T09199                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism clum  Cyclopterus lumpus (lumpfish) Pathway clum03420   Nucleotide excision repair clum04110   Cell cycle clum04114   Oocyte meiosis clum04120   Ubiquitin mediated proteolysis clum04141   Protein processing in endoplasmic reticulum clum04310   Wnt signaling pathway clum04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:clum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     117735638 (rbx1)    04120 Ubiquitin mediated proteolysis     117735638 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     117735638 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117735638 (rbx1)    04350 TGF-beta signaling pathway     117735638 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     117735638 (rbx1)    04114 Oocyte meiosis     117735638 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:clum04121]     117735638 (rbx1)    03400 DNA repair and recombination proteins [BR:clum03400]     117735638 (rbx1) Enzymes [BR:clum01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      117735638 (rbx1) Ubiquitin system [BR:clum04121]  Ubiquitin ligases (E3)   UBL E3 ligases    117735638 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      117735638 (rbx1)    Cul2 complex      117735638 (rbx1)    Cul3 complex      117735638 (rbx1)    Cul4 complex      117735638 (rbx1)    Cul7 complex      117735638 (rbx1)    Cul8 complex      117735638 (rbx1)    Cul9 complex      117735638 (rbx1) DNA repair and recombination proteins [BR:clum03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       117735638 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       117735638 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  117735638 NCBI-ProteinID:  XP_034396302 Ensembl:  ENSCLMG00005005119 UniProt:  A0A8C2WZC4 LinkDB All DBs Position 8:14594007..14596567 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagctatggatgttgatacaccgagcggcacgaacagtggagctagcaagaag cggtttgaagtgaagaagtggaatgctgtggcgctgtgggcctgggacatcgtggtggat aactgtgctatctgtcggaaccacatcatggacctctgtatagagtgccaggccaaccag gcctctgcgacctctgaggagtgcactgtagcctggggtgtctgcaatcatgccttccac ttccactgtatttcccgctggctgaaaaccagacaggtgtgtcctctggacaacagggag tgggagtttcagaaatacggacactag

DBGET integrated database retrieval system