Columba livia (rock pigeon): 102090996 Help Entry 102090996         CDS       T02912                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism clv  Columba livia (rock pigeon) Pathway clv04060   Cytokine-cytokine receptor interaction clv04672   Intestinal immune network for IgA production clv04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:clv00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102090996 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102090996 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     102090996 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clv04052]     102090996 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:clv00536]     102090996 (CXCL12) Cytokines and neuropeptides [BR:clv04052]  Cytokines   Chemokines    102090996 (CXCL12) Glycosaminoglycan binding proteins [BR:clv00536]  Heparan sulfate / Heparin   Chemokines    102090996 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102090996 NCBI-ProteinID:  XP_013226385 UniProt:  A0A2I0LY75 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MSSGNKGVSVSPGLCICAADAGARGSNVSFLSLCFTEKPVSLTYRCPCRFYESNVARANI KHLKILSTPNCSLQIVARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRG PLCPSRATPLKSPGRKNGGSRCKRQAL NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtcgtctgggaataaaggagtttctgtcagccctggtctgtgtatctgtgctgctgat gcgggagcaagagggagtaatgtgtcctttctctccctgtgtttcacagagaaacctgtc agcctgacttaccggtgcccatgtcgattctacgagagcaacgtggcaagagccaacatt aagcacctcaaaatcctctccacacccaactgctcacttcagattgttgcaaggctcaag agcaacagcaagcaagtgtgcattgatcccaagttaaagtggatccaggaatatctggag aaagctttaaacaaaccacgtcatcgcactcataaaaaaaagcaacagaagaaacggggc ccactctgcccttcccgtgcaacaccactaaagtctccagggaggaagaatggaggttca agatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system