Columba livia (rock pigeon): 102091775 Help Entry 102091775         CDS       T02912                                  Symbol DHFR Name (RefSeq) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism clv  Columba livia (rock pigeon) Pathway clv00670   One carbon pool by folate clv00790   Folate biosynthesis clv01100   Metabolic pathways clv01240   Biosynthesis of cofactors clv04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:clv00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     102091775 (DHFR)    00670 One carbon pool by folate     102091775 (DHFR)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     102091775 (DHFR) Enzymes [BR:clv01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      102091775 (DHFR) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-GeneID:  102091775 NCBI-ProteinID:  XP_005513894 UniProt:  A0A2I0LUW2 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MTSTTHVEGKQNAVVMGRKTWFSIPEKHRPLKDRINIVLSRELREAPEGAHYLSKSLDDA LTLLDSPELQSKVDMVWIIGGSSVYKAAMDKPINHRLFVTRILKEFESDTFFPEINCRDY KLLTEYPGVPAGIQEENGIQYKFEVYEKTVMAQ NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgacgagcacgacccacgtggaaggtaaacagaatgcagtggtaatgggtagaaaaacc tggttctccattcctgagaagcatcgtcctttaaaagacaggattaatatagtgctcagc agagagctcagggaagctccagaaggagcacattatctttccaaaagtctggatgatgct ttaactcttttggattcgccagagttacagagtaaagtagacatggtttggatcattgga ggctcttcagtttacaaggcagcgatggataagccaattaatcatcgattatttgtgaca agaattttgaaggaatttgaaagtgacacattttttccggaaatcaactgcagagactac aaacttcttacagagtacccaggtgtccctgctggtatccaagaagagaatggcatccag tacaaattcgaagtgtatgaaaaaactgtcatggcacaataa

DBGET integrated database retrieval system