Columba livia (rock pigeon): 102097240 Help Entry 102097240         CDS       T02912                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism clv  Columba livia (rock pigeon) Pathway clv04060   Cytokine-cytokine receptor interaction clv04068   FoxO signaling pathway clv04218   Cellular senescence clv04620   Toll-like receptor signaling pathway clv04621   NOD-like receptor signaling pathway clv04623   Cytosolic DNA-sensing pathway clv04625   C-type lectin receptor signaling pathway clv04672   Intestinal immune network for IgA production clv05132   Salmonella infection clv05164   Influenza A clv05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:clv00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     102097240 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102097240 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102097240 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102097240 (IL6)    04621 NOD-like receptor signaling pathway     102097240 (IL6)    04623 Cytosolic DNA-sensing pathway     102097240 (IL6)    04625 C-type lectin receptor signaling pathway     102097240 (IL6)    04672 Intestinal immune network for IgA production     102097240 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102097240 (IL6)    05168 Herpes simplex virus 1 infection     102097240 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     102097240 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:clv04052]     102097240 (IL6) Cytokines and neuropeptides [BR:clv04052]  Cytokines   Interleukins    102097240 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 GCSF IL23 IL11 DUF5481 Motif Other DBs NCBI-GeneID:  102097240 NCBI-ProteinID:  XP_013225347 UniProt:  A0A2I0MQA2 LinkDB All DBs Position Unknown AA seq 150 aa AA seqDB search MCEKFTVCGNSMEMLVQNNLNLPKMTEEDGCLFAGFDEDKCLRKISSGLYTFQTYLEYVK ETFISEKQSVDLLCYSTEHLARTIRQMVINPDEVIIPDPATQESLRAKLKSNKNWIEKIT THLILRDFTSFMEKTVRAVRYLKNTRSFSV NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atgtgcgagaagtttaccgtctgcgggaacagcatggagatgcttgtccagaacaacctc aacctccccaagatgacggaggaagacgggtgtctattcgccggctttgatgaggataaa tgcttgaggaaaatctccagcgggctttacacgtttcagacgtacctcgaatatgtaaaa gaaacttttattagtgaaaagcaaagcgtcgatttgctgtgctatagcacagagcacctg gcacgtaccataaggcagatggtgatcaatcccgatgaagtgatcatcccagacccagct acccaggaatccctccgtgcaaagctcaagtccaataagaactggatagagaaaatcacc actcacctcatcctccgagactttacttcatttatggagaaaactgtgagggctgttcgc tatttgaaaaacaccaggagtttcagtgtctga

DBGET integrated database retrieval system