Cucurbita maxima (winter squash): 111467831 Help Entry 111467831         CDS       T05246                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism cmax  Cucurbita maxima (winter squash) Pathway cmax00510   N-Glycan biosynthesis cmax00513   Various types of N-glycan biosynthesis cmax04141   Protein processing in endoplasmic reticulum Module cmax_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cmax00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111467831    00513 Various types of N-glycan biosynthesis     111467831  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111467831 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  111467831 NCBI-ProteinID:  XP_022968664 UniProt:  A0A6J1I0B1 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAPKPVTSPVPEAWYPTLAVLMIAVGLIITASFFIYEATTSRKNRSLATELTRGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccgaaacctgttacgagtcccgtccccgaagcctggtacccaacccttgcggtc ttgatgatcgctgttggccttatcattaccgcctcgtttttcatctatgaagctacaact tctaggaaaaaccgtagtctggccacggaacttacgagaggagccgttgcctcagttttc ttgggttttggatctttgttcttgctgcttgcttctggtgtttatgtctaa

DBGET integrated database retrieval system