Cucurbita maxima (winter squash): 111485321 Help Entry 111485321         CDS       T05246                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism cmax  Cucurbita maxima (winter squash) Pathway cmax00510   N-Glycan biosynthesis cmax00513   Various types of N-glycan biosynthesis cmax04141   Protein processing in endoplasmic reticulum Module cmax_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cmax00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111485321    00513 Various types of N-glycan biosynthesis     111485321  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111485321 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  111485321 NCBI-ProteinID:  XP_022987919 UniProt:  A0A6J1JK65 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAPKPVTSPVPEAWYPTLAVLMIAVGLVITASFFIYEATSSRKNRCLAKELTTGSFASVF LGFGSLFLLLASGIYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccgaaacctgttacgagtcccgtccccgaagcctggtacccgactcttgcggtc ctgatgatcgctgttggacttgtcattaccgcttcgtttttcatctatgaagctacatct tctaggaaaaaccgttgtcttgccaaggaactcactacaggatcatttgcctccgttttc ttgggttttggatccttgttcttgttgcttgcttctggtatttatgtctga

DBGET integrated database retrieval system