Cucurbita maxima (winter squash): 111485682 Help Entry 111485682         CDS       T05246                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cmax  Cucurbita maxima (winter squash) Pathway cmax03420   Nucleotide excision repair cmax04120   Ubiquitin mediated proteolysis cmax04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmax00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111485682    04120 Ubiquitin mediated proteolysis     111485682   09124 Replication and repair    03420 Nucleotide excision repair     111485682  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmax04121]     111485682    03400 DNA repair and recombination proteins [BR:cmax03400]     111485682 Enzymes [BR:cmax01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111485682 Ubiquitin system [BR:cmax04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111485682   Multi subunit type E3    SCF complex     Ring finger protein      111485682    Cul2 complex      111485682    Cul3 complex      111485682    Cul4 complex      111485682    Cul7 complex      111485682    Cul8 complex      111485682    Cul9 complex      111485682 DNA repair and recombination proteins [BR:cmax03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111485682     TCR (transcription coupled repair) factors      Cul4-CSA complex       111485682 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  111485682 NCBI-ProteinID:  XP_022988432 UniProt:  A0A6J1I027 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEASSSAGPSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctacgttggattccgatgtgcctatggttcccgcgggtgaggcttcgagtagtgct ggcccttcgtcttccaaaaaacctaagcgatttgagatcaaaaagtggaatgctgtcgct ctctgggcttgggatattgttgtcgataactgtgcaatttgtaggaatcacatcatggat ctctgcattgaatgtcaagcgaatcaggcgagtgccactagtgaggaatgtaccgtcgcc tggggggtatgcaaccatgcttttcacttccactgcattagtcgttggctgaagactcgc caagtttgtccattggataacagcgaatgggagttccagaagtatggacattag

DBGET integrated database retrieval system