Callorhinchus milii (elephant shark): 103183201 Help Entry 103183201         CDS       T03088                                  Symbol bcl2a Name (RefSeq) apoptosis regulator Bcl-2a   KO K02161   apoptosis regulator Bcl-2 Organism cmk  Callorhinchus milii (elephant shark) Pathway cmk04115   p53 signaling pathway cmk04140   Autophagy - animal cmk04141   Protein processing in endoplasmic reticulum cmk04210   Apoptosis cmk04217   Necroptosis cmk04261   Adrenergic signaling in cardiomyocytes cmk04340   Hedgehog signaling pathway cmk04510   Focal adhesion cmk04621   NOD-like receptor signaling pathway cmk05132   Salmonella infection cmk05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:cmk00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103183201 (bcl2a)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     103183201 (bcl2a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103183201 (bcl2a)   09143 Cell growth and death    04210 Apoptosis     103183201 (bcl2a)    04217 Necroptosis     103183201 (bcl2a)    04115 p53 signaling pathway     103183201 (bcl2a)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103183201 (bcl2a)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103183201 (bcl2a)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103183201 (bcl2a)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103183201 (bcl2a)   09171 Infectious disease: bacterial    05132 Salmonella infection     103183201 (bcl2a)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cmk01009]     103183201 (bcl2a) Protein phosphatases and associated proteins [BR:cmk01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103183201 (bcl2a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 DUF3311 Motif Other DBs NCBI-GeneID:  103183201 NCBI-ProteinID:  XP_007898732 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MSYESRELVFHYLYYRVSRHGYVWEEALGSAADSPHTSTPPAPAPAPAPASAALEKLHRV LREVGDSFERQYQQEFADIALQMRFEPDGARSRFDAVAEELFRDGINWGRIVAFFVFGGT LCVESCKRRDMAPLVDSIAAWMTAYLDSSLANWISANGDWDAFVELYGNNAHRFFDIPLP HLWTALAFAAVVTCVTIAYLAHQY NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgtcctacgagagccgtgagctggtgtttcactacctgtattaccgtgtgtcccggcac ggctatgtgtgggaggaggctctgggcagcgctgccgactccccgcacaccagcaccccc ccggccccggccccggcccccgcccccgcctcggccgccctggagaagctgcaccgtgtc ctgcgggaggtgggcgacagcttcgagcggcagtaccagcaggagttcgccgacatcgcg ctgcagatgcgctttgagccggacggcgcccgcagccgcttcgacgctgtggccgaggag ctgttccgagatgggatcaactggggccgcatcgtggctttcttcgtcttcggcggcacc ttgtgcgtggagagctgcaagaggagggacatggccccgctggtggacagcatcgccgcc tggatgaccgcctacctggacagcagcctggccaactggatcagcgccaatggagactgg gatgcctttgtggaactttatgggaacaacgcgcatcgcttctttgacatcccgttgcca catctttggactgccttggcttttgcagctgtggtgacttgtgtaacaattgcttatctg gcccaccagtattaa

DBGET integrated database retrieval system