Cucumis melo (muskmelon): 103492371 Help Entry 103492371         CDS       T03195                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cmo  Cucumis melo (muskmelon) Pathway cmo03420   Nucleotide excision repair cmo04120   Ubiquitin mediated proteolysis cmo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103492371    04120 Ubiquitin mediated proteolysis     103492371   09124 Replication and repair    03420 Nucleotide excision repair     103492371  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmo04121]     103492371    03400 DNA repair and recombination proteins [BR:cmo03400]     103492371 Enzymes [BR:cmo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103492371 Ubiquitin system [BR:cmo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103492371   Multi subunit type E3    SCF complex     Ring finger protein      103492371    Cul2 complex      103492371    Cul3 complex      103492371    Cul4 complex      103492371    Cul7 complex      103492371    Cul8 complex      103492371    Cul9 complex      103492371 DNA repair and recombination proteins [BR:cmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103492371     TCR (transcription coupled repair) factors      Cul4-CSA complex       103492371 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  103492371 NCBI-ProteinID:  XP_008450927 UniProt:  A0A1S3BQE3 LinkDB All DBs Position 2:complement(2618062..2619740) Genome browser AA seq 117 aa AA seqDB search MATLDTDVPMVPAGEASSSAGPSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctaccttggataccgatgtccctatggttcccgccggtgaagcttcaagcagtgct ggcccttcgtcttccaaaaaacctaagcgatttgagatcaagaagtggaacgctgtcgct ctctgggcttgggatattgttgtcgataactgtgcaatttgtaggaatcacataatggat ctttgtattgaatgtcaggcgaatcaagcgagtgctaccagtgaggaatgcactgttgcc tggggggtatgcaaccatgctttccacttccactgcattagtcgttggttgaagactcgc caagtttgtccattagacaacagcgaatgggagttccagaagtatggacattag

DBGET integrated database retrieval system