Cucumis melo (muskmelon): 103498857 Help Entry 103498857         CDS       T03195                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cmo  Cucumis melo (muskmelon) Pathway cmo03420   Nucleotide excision repair cmo04120   Ubiquitin mediated proteolysis cmo04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103498857    04120 Ubiquitin mediated proteolysis     103498857   09124 Replication and repair    03420 Nucleotide excision repair     103498857  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmo04121]     103498857    03400 DNA repair and recombination proteins [BR:cmo03400]     103498857 Enzymes [BR:cmo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      103498857 Ubiquitin system [BR:cmo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    103498857   Multi subunit type E3    SCF complex     Ring finger protein      103498857    Cul2 complex      103498857    Cul3 complex      103498857    Cul4 complex      103498857    Cul7 complex      103498857    Cul8 complex      103498857    Cul9 complex      103498857 DNA repair and recombination proteins [BR:cmo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       103498857     TCR (transcription coupled repair) factors      Cul4-CSA complex       103498857 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  103498857 NCBI-ProteinID:  XP_008459863 UniProt:  A0A1S3CBM5 LinkDB All DBs Position 5:30192918..30195613 Genome browser AA seq 117 aa AA seqDB search MATLDSDVPMVSAVEASSSAGPSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggccaccttggattccgacgttccaatggtttctgccgtcgaggcttcgagcagtgcc ggtccttcatctaccaagaaacccaagcgttttgagatcaaaaagtggaacgccgtcgct ctttgggcatgggatatcgttgtcgataactgtgcgatctgtaggaaccatatcatggat ctttgtattgagtgtcaagcaaaccaggccagcgcaaccagcgaggaatgtactgtagcg tggggggtgtgtaatcatgcatttcatttccactgtatcagcagatggttgaagacacgt caagtttgcccattggataatagcgaatgggaatttcagaagtatggtcactag

DBGET integrated database retrieval system