Cucurbita moschata (crookneck pumpkin): 111433278 Help Entry 111433278         CDS       T05248                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos00510   N-Glycan biosynthesis cmos00513   Various types of N-glycan biosynthesis cmos04141   Protein processing in endoplasmic reticulum Module cmos_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:cmos00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     111433278    00513 Various types of N-glycan biosynthesis     111433278  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111433278 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 Motif Other DBs NCBI-GeneID:  111433278 NCBI-ProteinID:  XP_022926045 UniProt:  A0A6J1EJW7 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAPKPVTSPVPEAWYPTLAVLMIAVGLIITASFFIYEATTSRKNRSLATELTRGAVASVF LGFGSLFLLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggctccgaaacctgttacgagtcccgtccccgaagcctggtacccaacccttgcggtc ttgatgatcgctgttggccttatcattactgcctcgtttttcatctatgaagctacaact tctaggaaaaaccgtagtctggccacggaacttacgagaggagccgttgcctcagttttc ttgggttttggatccttgttcttgctgcttgcttctggtgtttatgtctaa

DBGET integrated database retrieval system