Cucurbita moschata (crookneck pumpkin): 111444049 Help Entry 111444049         CDS       T05248                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos03420   Nucleotide excision repair cmos04120   Ubiquitin mediated proteolysis cmos04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmos00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111444049    04120 Ubiquitin mediated proteolysis     111444049   09124 Replication and repair    03420 Nucleotide excision repair     111444049  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmos04121]     111444049    03400 DNA repair and recombination proteins [BR:cmos03400]     111444049 Enzymes [BR:cmos01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111444049 Ubiquitin system [BR:cmos04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111444049   Multi subunit type E3    SCF complex     Ring finger protein      111444049    Cul2 complex      111444049    Cul3 complex      111444049    Cul4 complex      111444049    Cul7 complex      111444049    Cul8 complex      111444049    Cul9 complex      111444049 DNA repair and recombination proteins [BR:cmos03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111444049     TCR (transcription coupled repair) factors      Cul4-CSA complex       111444049 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  111444049 NCBI-ProteinID:  XP_022937741 UniProt:  A0A6J1FB79 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MDSDVTMVPVGEASSSAGPSSTKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCI ECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggactccgacgtgacgatggttccggtcggcgaggcttcgagcagtgccggtccttcg tctaccaagaaacccaagcgttttgagatcaaaaagtggaacgccgtcgctctatgggca tgggatatcgttgtcgataactgtgcgatctgcagaaatcatatcatggatctttgcatc gagtgccaagcaaaccaggcaagcgcaaccagcgaggaatgtactgtggcttggggggtg tgtaatcatgcatttcatttccactgtatcagtagatggttgaagacgcgtcaagtttgc ccattggataatagcgagtgggaatttcagaagtacggtcactag

DBGET integrated database retrieval system