Cucurbita moschata (crookneck pumpkin): 111461500 Help Entry 111461500         CDS       T05248                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cmos  Cucurbita moschata (crookneck pumpkin) Pathway cmos03420   Nucleotide excision repair cmos04120   Ubiquitin mediated proteolysis cmos04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cmos00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111461500    04120 Ubiquitin mediated proteolysis     111461500   09124 Replication and repair    03420 Nucleotide excision repair     111461500  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmos04121]     111461500    03400 DNA repair and recombination proteins [BR:cmos03400]     111461500 Enzymes [BR:cmos01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111461500 Ubiquitin system [BR:cmos04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111461500   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      111461500    Cul2 complex      111461500    Cul3 complex      111461500    Cul4 complex      111461500    Cul7 complex      111461500    Cul8 complex      111461500    Cul9 complex      111461500 DNA repair and recombination proteins [BR:cmos03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111461500     TCR (transcription coupled repair) factors      Cul4-CSA complex       111461500 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  111461500 NCBI-ProteinID:  XP_022960807 UniProt:  A0A6J1F460 LinkDB All DBs Position Unknown AA seq 117 aa AA seqDB search MATLDSDVPMVPAGEASSSAGPSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctacgttggattccgatgtgccgatggttcccgcgggtgaggcttcgagtagtgct ggcccttcgtcttccaaaaaacctaagcgatttgagatcaaaaagtggaatgctgtcgct ctctgggcttgggatattgttgtcgataactgtgcaatttgtaggaatcatatcatggat ctctgcattgaatgtcaagcgaatcaggcgagtgccactagtgaggaatgtaccgtcgcc tggggggtatgcaaccatgcttttcacttccactgcattagtcgttggctgaagactcgc caagtttgtccattggataacagcgaatgggagttccagaagtatggacattag

DBGET integrated database retrieval system