Chelonia mydas (green sea turtle): 102932326 Help Entry 102932326         CDS       T02989                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04060   Cytokine-cytokine receptor interaction cmy04672   Intestinal immune network for IgA production cmy04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:cmy00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102932326 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102932326 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     102932326 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cmy04052]     102932326 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:cmy00536]     102932326 (CXCL12) Cytokines and neuropeptides [BR:cmy04052]  Cytokines   Chemokines    102932326 (CXCL12) Glycosaminoglycan binding proteins [BR:cmy00536]  Heparan sulfate / Heparin   Chemokines    102932326 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102932326 NCBI-ProteinID:  XP_027687500 LinkDB All DBs Position 7:complement(58716612..58739005) Genome browser AA seq 93 aa AA seqDB search MDGKALALVTCLLLSLSPSEEKPVSLTYRCPCRFYESNVAKANIKHLKILTTPNCSLQIV ARLKNNSKQVCIDPKLKWIQEYLEKALNKRFKM NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggacgggaaagccctggcgctggtcacttgtctgctgctctctctctccccctcggag gagaaacccgtcagcctgacctaccgatgcccctgcaggttctacgagagcaacgtggct aaagccaacatcaagcacctcaaaatcctgaccaccccgaattgctcgctgcagattgta gcaaggctgaagaacaacagtaagcaagtgtgcattgatcccaagttaaagtggattcag gaatatctggagaaagctttaaacaagaggttcaagatgtaa

DBGET integrated database retrieval system