Chelonia mydas (green sea turtle): 102943754 Help Entry 102943754         CDS       T02989                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy03420   Nucleotide excision repair cmy04110   Cell cycle cmy04114   Oocyte meiosis cmy04120   Ubiquitin mediated proteolysis cmy04141   Protein processing in endoplasmic reticulum cmy04310   Wnt signaling pathway cmy04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:cmy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102943754 (RBX1)    04120 Ubiquitin mediated proteolysis     102943754 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     102943754 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102943754 (RBX1)    04350 TGF-beta signaling pathway     102943754 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102943754 (RBX1)    04114 Oocyte meiosis     102943754 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cmy04121]     102943754 (RBX1)    03400 DNA repair and recombination proteins [BR:cmy03400]     102943754 (RBX1) Enzymes [BR:cmy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102943754 (RBX1) Ubiquitin system [BR:cmy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102943754 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      102943754 (RBX1)    Cul2 complex      102943754 (RBX1)    Cul3 complex      102943754 (RBX1)    Cul4 complex      102943754 (RBX1)    Cul7 complex      102943754 (RBX1)    Cul8 complex      102943754 (RBX1)    Cul9 complex      102943754 (RBX1) DNA repair and recombination proteins [BR:cmy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102943754 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       102943754 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  102943754 NCBI-ProteinID:  XP_007053371 LinkDB All DBs Position 1:257483736..257497809 Genome browser AA seq 120 aa AA seqDB search MRNKGTWNRVFKMAAAMDVDTPSGTNSSASKKRFEVKKWNAVALWAWDIVVDNCAICRNH IMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgcgcaataaggggacctggaatcgtgtattcaaaatggcggcggcgatggatgtggac accccgagcggcaccaatagcagcgccagtaagaagcgcttcgaagtgaagaagtggaat gcagtagctctctgggcctgggacattgtggttgataactgtgccatttgcaggaaccat atcatggatctgtgtatagaatgtcaagctaaccaggcatcggctacctctgaagagtgt actgtcgcatggggtgtctgcaatcatgctttccacttccactgcatctctcgttggctt aagactcgccaggtgtgtccactggacaacagagaatgggagttccaaaagtatgggcac taa

DBGET integrated database retrieval system