Cryptococcus deneoformans B-3501A: CNBA7410 Help Entry CNBA7410          CDS       T01040                                  Name (RefSeq) hypothetical protein   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism cnb  Cryptococcus deneoformans B-3501A Pathway cnb03018   RNA degradation cnb03040   Spliceosome Brite KEGG Orthology (KO) [BR:cnb00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     CNBA7410   09123 Folding, sorting and degradation    03018 RNA degradation     CNBA7410  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cnb03019]     CNBA7410    03041 Spliceosome [BR:cnb03041]     CNBA7410 Messenger RNA biogenesis [BR:cnb03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      CNBA7410   mRNA degradation factors    5'-3' decay     Lsm complex      CNBA7410 Spliceosome [BR:cnb03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     CNBA7410  Complex C   U2 snRNP components     CNBA7410 SSDB OrthologParalogGFIT Motif Pfam:  LSM SM-ATX DUF4362 DUF7714 Motif Other DBs NCBI-GeneID:  4934007 NCBI-ProteinID:  XP_777620 LinkDB All DBs Position 1 Genome browser AA seq 95 aa AA seqDB search MDAVVNSQIQEPLDLVKLALGERVLIKLRGDRIVTGVLHAYDAHMNVVISQAEESIHVVD VTEEGQPLPPRIERRTAEMLFVRGDGVILLSPAEQ NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggacgccgtggtcaattctcaaattcaagagcctctagacctcgtcaagcttgccctc ggagagcgtgttttgattaagcttagaggtgacagaatagtcactggtgttcttcacgct tatgacgcccacatgaacgttgtcatctctcaagcagaggaatccatccatgttgtcgac gtgaccgaagaaggacagcccttaccacctaggatcgagagacggactgccgagatgttg ttcgttcgaggagacggtgtgattctcctttcaccggcagagcaataa

DBGET integrated database retrieval system