Cryptococcus neoformans var. grubii H99: CNAG_05998 Help Entry CNAG_05998        CDS       T08175                                  Name (RefSeq) rho family protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cng  Cryptococcus neoformans var. grubii H99 Pathway cng04145   Phagosome cng04148   Efferocytosis cng04620   Toll-like receptor signaling pathway cng05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cng00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     CNAG_05998    04148 Efferocytosis     CNAG_05998  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     CNAG_05998  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     CNAG_05998  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cng04131]     CNAG_05998   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cng04147]     CNAG_05998    04031 GTP-binding proteins [BR:cng04031]     CNAG_05998 Membrane trafficking [BR:cng04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     CNAG_05998  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     CNAG_05998   Macropinocytosis    Ras GTPases     CNAG_05998  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     CNAG_05998 Exosome [BR:cng04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    CNAG_05998   Exosomal proteins of other body fluids (saliva and urine)    CNAG_05998   Exosomal proteins of colorectal cancer cells    CNAG_05998   Exosomal proteins of bladder cancer cells    CNAG_05998 GTP-binding proteins [BR:cng04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     CNAG_05998 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  23889257 NCBI-ProteinID:  XP_012052960 UniProt:  J9VXT9 LinkDB All DBs Position 12:43519..45667 Genome browser AA seq 199 aa AA seqDB search MAMQSIKCVVVGDGAVGKTCLLISYTTNSFPGEYVPTVFDNYSASVLVDGRPVSLGLWDT AGQEDYDRLRPLSYPQTDVFLVCFSIVSPPSFENVKTKWIPEIRHHAPTTPILLIGTKLD LRDDPVTLSRLKERRFQPIGFEMGVRCAREIGAVRYLEASSRTQKGLKNVFDEAIRAVLS PSARDAREKKKKKQQCLIL NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atggccatgcagagtatcaaatgcgtcgtcgtcggtgacggtgccgtcggaaagacatgt ctcttgatttcatacaccaccaactcttttcccggggaatacgtccctactgtgtttgac aactactctgccagcgtactcgttgatggtcggccagtcagtttgggattatgggatact gccggacaggaagactatgaccggctaagaccactatcctacccacagaccgacgtattc ctcgtctgtttctcaatcgtctccccaccaagtttcgaaaatgtcaaaactaaatggatc cccgaaatccggcaccacgctccaactacccccatccttctgatcggcaccaaactcgat ctccgagacgaccctgtcaccctctctcgtctgaaagaacgtcgtttccaaccgatcggg tttgagatgggtgtcagatgtgcgagggagattggggctgttaggtatttggaggcttct agtcggacgcaaaaaggcttgaaaaatgtattcgacgaagcgatccgtgcggtactcagt ccctctgcaagggacgcaagggagaagaagaagaagaaacagcagtgtttgattctctga

DBGET integrated database retrieval system