Coprococcus sp. ART55/1: CCU_23250 Help Entry CCU_23250         CDS       T02583                                  Name (GenBank) Ferredoxin   KO K00395   adenylylsulfate reductase, subunit B [EC:1.8.99.2] Organism coo  Coprococcus sp. ART55/1 Pathway coo00920   Sulfur metabolism coo01100   Metabolic pathways coo01120   Microbial metabolism in diverse environments coo01320   Sulfur cycle Brite KEGG Orthology (KO) [BR:coo00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     CCU_23250 Enzymes [BR:coo01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.99  With unknown physiological acceptors     1.8.99.2  adenylyl-sulfate reductase      CCU_23250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_21 Fer4_4 Fer4_2 Fer4_17 Fer4_8 Fer4_3 Fer4_15 Fer4_11 Motif Other DBs NCBI-ProteinID:  CBK83718 LinkDB All DBs Position 2464247..2464561 Genome browser AA seq 104 aa AA seqDB search MSIVINKELCKNCGKCANVCPGYLIKRDEDGQIFMKYPKDCWGCSSCIKECAFDAISLYL GADIGGMGSQMSVENKGDLLLWNIRKMDGTTDQIVIDKKEANKY NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagcatagtgataaataaagagctttgcaaaaactgcggcaaatgtgcaaatgtctgc ccgggttacctcataaagagagatgaggatggacagatattcatgaaatacccaaaggat tgctggggatgctcatcctgtatcaaggagtgtgcatttgacgccatctcattatatctc ggagctgacatcggcggaatgggaagccagatgtcggtggagaacaaaggagatctgctt ctgtggaatatccgcaagatggatggcaccacagaccagatagtgatagacaagaaggaa gctaataaatattaa

DBGET integrated database retrieval system