Carica papaya (papaya): 110817690 Help Entry 110817690         CDS       T05151                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cpap  Carica papaya (papaya) Pathway cpap03420   Nucleotide excision repair cpap04120   Ubiquitin mediated proteolysis cpap04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cpap00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110817690    04120 Ubiquitin mediated proteolysis     110817690   09124 Replication and repair    03420 Nucleotide excision repair     110817690  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cpap04121]     110817690    03400 DNA repair and recombination proteins [BR:cpap03400]     110817690 Enzymes [BR:cpap01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110817690 Ubiquitin system [BR:cpap04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110817690   Multi subunit type E3    SCF complex     Ring finger protein      110817690    Cul2 complex      110817690    Cul3 complex      110817690    Cul4 complex      110817690    Cul7 complex      110817690    Cul8 complex      110817690    Cul9 complex      110817690 DNA repair and recombination proteins [BR:cpap03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110817690     TCR (transcription coupled repair) factors      Cul4-CSA complex       110817690 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  110817690 NCBI-ProteinID:  XP_021902023 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MATLDSDVPMVPVGEASSSSAPSSSAKKPKRFEIKKWSAVALWAWDIVVDNCAICRNHIM DLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggctactttggactccgatgtgcccatggttccggttggcgaagcttcaagcagcagc gctccttcctcttccgccaagaagcccaagcgtttcgagatcaaaaagtggagcgccgtc gctctctgggcatgggatattgttgtagataactgtgcaatctgcaggaaccacattatg gatctctgcatagagtgccaagcgaaccaggctagcgctaccagcgaggaatgcactgtt gcttggggagtttgcaaccatgcatttcacttccattgcatcagccgatggctgaagact cgtcaagtttgcccattggataacagcgagtgggagttccagaagtatggacactaa

DBGET integrated database retrieval system