Chaetura pelagica (chimney swift): 104387596 Help Entry 104387596         CDS       T08631                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cpea  Chaetura pelagica (chimney swift) Pathway cpea03420   Nucleotide excision repair cpea04110   Cell cycle cpea04114   Oocyte meiosis cpea04120   Ubiquitin mediated proteolysis cpea04141   Protein processing in endoplasmic reticulum cpea04310   Wnt signaling pathway cpea04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:cpea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     104387596 (RBX1)    04120 Ubiquitin mediated proteolysis     104387596 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     104387596 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     104387596 (RBX1)    04350 TGF-beta signaling pathway     104387596 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     104387596 (RBX1)    04114 Oocyte meiosis     104387596 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cpea04121]     104387596 (RBX1)    03400 DNA repair and recombination proteins [BR:cpea03400]     104387596 (RBX1) Enzymes [BR:cpea01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      104387596 (RBX1) Ubiquitin system [BR:cpea04121]  Ubiquitin ligases (E3)   UBL E3 ligases    104387596 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      104387596 (RBX1)    Cul2 complex      104387596 (RBX1)    Cul3 complex      104387596 (RBX1)    Cul4 complex      104387596 (RBX1)    Cul7 complex      104387596 (RBX1)    Cul8 complex      104387596 (RBX1)    Cul9 complex      104387596 (RBX1) DNA repair and recombination proteins [BR:cpea03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       104387596 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       104387596 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  104387596 NCBI-ProteinID:  XP_009994672 LinkDB All DBs Position Unknown AA seq 148 aa AA seqDB search MPVVFVFAETQSARAALALPTNPTPFITVVSLIHALEAREARGLPLAALASHLKEPTAWN AVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWL KTRQVCPLDNREWEFQKSVVRIIQEIHE NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgcccgttgtcttcgtcttcgcggaaacacagagcgctcgggcggctctagccctgcca acaaaccccacgccgtttataactgttgtcagcctaattcacgcgctggaagcccgcgaa gcgcgcggcctgcctctggccgctttggcgtcccatttaaaagaaccaacagcgtggaat gcagtagctctgtgggcatgggacattgtggtcgataactgtgccatttgcagaaaccat attatggatctatgcatagaatgtcaagcaaaccaagcatcagctacctctgaagagtgc acagttgcatggggtgtctgcaatcatgctttccacttccactgcatctctcgctggctc aaaactcgccaagtatgtccactggacaacagggaatgggagttccaaaagtctgttgtt agaataatacaggaaatccatgagtaa

DBGET integrated database retrieval system