Cavia porcellus (domestic guinea pig): 100135630 Help Entry 100135630         CDS       T07777                                  Symbol Tnf Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc01523   Antifolate resistance cpoc04010   MAPK signaling pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04061   Viral protein interaction with cytokine and cytokine receptor cpoc04064   NF-kappa B signaling pathway cpoc04071   Sphingolipid signaling pathway cpoc04150   mTOR signaling pathway cpoc04210   Apoptosis cpoc04217   Necroptosis cpoc04350   TGF-beta signaling pathway cpoc04380   Osteoclast differentiation cpoc04612   Antigen processing and presentation cpoc04620   Toll-like receptor signaling pathway cpoc04621   NOD-like receptor signaling pathway cpoc04622   RIG-I-like receptor signaling pathway cpoc04625   C-type lectin receptor signaling pathway cpoc04640   Hematopoietic cell lineage cpoc04650   Natural killer cell mediated cytotoxicity cpoc04657   IL-17 signaling pathway cpoc04660   T cell receptor signaling pathway cpoc04664   Fc epsilon RI signaling pathway cpoc04668   TNF signaling pathway cpoc04920   Adipocytokine signaling pathway cpoc04930   Type II diabetes mellitus cpoc04931   Insulin resistance cpoc04932   Non-alcoholic fatty liver disease cpoc04933   AGE-RAGE signaling pathway in diabetic complications cpoc04936   Alcoholic liver disease cpoc04940   Type I diabetes mellitus cpoc05010   Alzheimer disease cpoc05014   Amyotrophic lateral sclerosis cpoc05020   Prion disease cpoc05022   Pathways of neurodegeneration - multiple diseases cpoc05132   Salmonella infection cpoc05133   Pertussis cpoc05134   Legionellosis cpoc05135   Yersinia infection cpoc05140   Leishmaniasis cpoc05142   Chagas disease cpoc05143   African trypanosomiasis cpoc05144   Malaria cpoc05145   Toxoplasmosis cpoc05146   Amoebiasis cpoc05152   Tuberculosis cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05163   Human cytomegalovirus infection cpoc05164   Influenza A cpoc05165   Human papillomavirus infection cpoc05166   Human T-cell leukemia virus 1 infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05171   Coronavirus disease - COVID-19 cpoc05205   Proteoglycans in cancer cpoc05310   Asthma cpoc05321   Inflammatory bowel disease cpoc05322   Systemic lupus erythematosus cpoc05323   Rheumatoid arthritis cpoc05330   Allograft rejection cpoc05332   Graft-versus-host disease cpoc05410   Hypertrophic cardiomyopathy cpoc05414   Dilated cardiomyopathy cpoc05417   Lipid and atherosclerosis cpoc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100135630 (Tnf)    04350 TGF-beta signaling pathway     100135630 (Tnf)    04064 NF-kappa B signaling pathway     100135630 (Tnf)    04668 TNF signaling pathway     100135630 (Tnf)    04071 Sphingolipid signaling pathway     100135630 (Tnf)    04150 mTOR signaling pathway     100135630 (Tnf)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100135630 (Tnf)    04061 Viral protein interaction with cytokine and cytokine receptor     100135630 (Tnf)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100135630 (Tnf)    04217 Necroptosis     100135630 (Tnf)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100135630 (Tnf)    04620 Toll-like receptor signaling pathway     100135630 (Tnf)    04621 NOD-like receptor signaling pathway     100135630 (Tnf)    04622 RIG-I-like receptor signaling pathway     100135630 (Tnf)    04625 C-type lectin receptor signaling pathway     100135630 (Tnf)    04650 Natural killer cell mediated cytotoxicity     100135630 (Tnf)    04612 Antigen processing and presentation     100135630 (Tnf)    04660 T cell receptor signaling pathway     100135630 (Tnf)    04657 IL-17 signaling pathway     100135630 (Tnf)    04664 Fc epsilon RI signaling pathway     100135630 (Tnf)   09152 Endocrine system    04920 Adipocytokine signaling pathway     100135630 (Tnf)   09158 Development and regeneration    04380 Osteoclast differentiation     100135630 (Tnf)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100135630 (Tnf)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100135630 (Tnf)    05170 Human immunodeficiency virus 1 infection     100135630 (Tnf)    05161 Hepatitis B     100135630 (Tnf)    05160 Hepatitis C     100135630 (Tnf)    05171 Coronavirus disease - COVID-19     100135630 (Tnf)    05164 Influenza A     100135630 (Tnf)    05168 Herpes simplex virus 1 infection     100135630 (Tnf)    05163 Human cytomegalovirus infection     100135630 (Tnf)    05169 Epstein-Barr virus infection     100135630 (Tnf)    05165 Human papillomavirus infection     100135630 (Tnf)   09171 Infectious disease: bacterial    05132 Salmonella infection     100135630 (Tnf)    05135 Yersinia infection     100135630 (Tnf)    05133 Pertussis     100135630 (Tnf)    05134 Legionellosis     100135630 (Tnf)    05152 Tuberculosis     100135630 (Tnf)   09174 Infectious disease: parasitic    05146 Amoebiasis     100135630 (Tnf)    05144 Malaria     100135630 (Tnf)    05145 Toxoplasmosis     100135630 (Tnf)    05140 Leishmaniasis     100135630 (Tnf)    05142 Chagas disease     100135630 (Tnf)    05143 African trypanosomiasis     100135630 (Tnf)   09163 Immune disease    05310 Asthma     100135630 (Tnf)    05322 Systemic lupus erythematosus     100135630 (Tnf)    05323 Rheumatoid arthritis     100135630 (Tnf)    05321 Inflammatory bowel disease     100135630 (Tnf)    05330 Allograft rejection     100135630 (Tnf)    05332 Graft-versus-host disease     100135630 (Tnf)   09164 Neurodegenerative disease    05010 Alzheimer disease     100135630 (Tnf)    05014 Amyotrophic lateral sclerosis     100135630 (Tnf)    05020 Prion disease     100135630 (Tnf)    05022 Pathways of neurodegeneration - multiple diseases     100135630 (Tnf)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100135630 (Tnf)    05418 Fluid shear stress and atherosclerosis     100135630 (Tnf)    05410 Hypertrophic cardiomyopathy     100135630 (Tnf)    05414 Dilated cardiomyopathy     100135630 (Tnf)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100135630 (Tnf)    04940 Type I diabetes mellitus     100135630 (Tnf)    04936 Alcoholic liver disease     100135630 (Tnf)    04932 Non-alcoholic fatty liver disease     100135630 (Tnf)    04931 Insulin resistance     100135630 (Tnf)    04933 AGE-RAGE signaling pathway in diabetic complications     100135630 (Tnf)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     100135630 (Tnf)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100135630 (Tnf)    00536 Glycosaminoglycan binding proteins [BR:cpoc00536]     100135630 (Tnf) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Tumor necrosis fators    100135630 (Tnf) Glycosaminoglycan binding proteins [BR:cpoc00536]  Heparan sulfate / Heparin   Cytokines    100135630 (Tnf) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  100135630 NCBI-ProteinID:  NP_001166496 Ensembl:  ENSCPOG00000002343 UniProt:  P51435 A0A0U5J7Z4 LinkDB All DBs AA seq 234 aa AA seqDB search MSTESMIRDVELAEEQLPKKAGGPQGSRRCWCLSLFSFLLVAGATTLFCLLHFGVIGPQR EEQFSSGPPFRPLAQTLTLRSASQNDNDKPVAHVVANQQAEEELQWLSKRANALLANGMG LSDNQLVVPSDGLYLIYSQVLFKGQGCPSYLLLTHTVSRLAVSYPEKVNLLSAIKSPCQK ETPEGAERKPWYEPIYLGGVFQLQKGDRLSAEVNLPQYLDFADSGQIYFGVIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcacagaaagcatgatccgggacgtggagctcgcagaggagcagctccccaagaag gcagggggcccccagggctccaggcggtgctggtgcctcagcctcttctccttcctgctg gtggcaggggccaccacgctcttctgcctgctgcactttggggtgatcggcccccagcgg gaagagcagttctccagtggcccccccttcagacccctggcccagacgctcacactcaga tcagcttctcaaaacgataatgacaagccggtggctcatgttgtggcaaaccagcaagca gaggaggagctgcagtggctcagcaagcgtgctaacgccctcctggccaatggcatgggc ctgagcgacaaccagctggtggtgccttcggatgggctgtacctcatctactcccaggtc ctcttcaagggccaaggctgcccctcctacctgcttctcacccataccgtcagccgcttg gccgtctcctacccggaaaaggtcaaccttctctctgccatcaagagtccctgccagaag gagaccccagaaggggctgagcgcaagccctggtatgaacccatctacctgggaggcgtc ttccagctgcagaagggtgaccggctcagcgctgaggtcaacctgcctcagtaccttgac tttgccgattccgggcagatctactttggggtcattgccctgtga

DBGET integrated database retrieval system