Cavia porcellus (domestic guinea pig): 100379269 Help Entry 100379269         CDS       T07777                                  Symbol Tp53 Name (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc01522   Endocrine resistance cpoc01524   Platinum drug resistance cpoc04010   MAPK signaling pathway cpoc04071   Sphingolipid signaling pathway cpoc04110   Cell cycle cpoc04115   p53 signaling pathway cpoc04137   Mitophagy - animal cpoc04151   PI3K-Akt signaling pathway cpoc04210   Apoptosis cpoc04211   Longevity regulating pathway cpoc04216   Ferroptosis cpoc04218   Cellular senescence cpoc04310   Wnt signaling pathway cpoc04722   Neurotrophin signaling pathway cpoc04919   Thyroid hormone signaling pathway cpoc05012   Parkinson disease cpoc05014   Amyotrophic lateral sclerosis cpoc05016   Huntington disease cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05162   Measles cpoc05163   Human cytomegalovirus infection cpoc05165   Human papillomavirus infection cpoc05166   Human T-cell leukemia virus 1 infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05200   Pathways in cancer cpoc05202   Transcriptional misregulation in cancer cpoc05203   Viral carcinogenesis cpoc05205   Proteoglycans in cancer cpoc05206   MicroRNAs in cancer cpoc05210   Colorectal cancer cpoc05212   Pancreatic cancer cpoc05213   Endometrial cancer cpoc05214   Glioma cpoc05215   Prostate cancer cpoc05216   Thyroid cancer cpoc05217   Basal cell carcinoma cpoc05218   Melanoma cpoc05219   Bladder cancer cpoc05220   Chronic myeloid leukemia cpoc05222   Small cell lung cancer cpoc05223   Non-small cell lung cancer cpoc05224   Breast cancer cpoc05225   Hepatocellular carcinoma cpoc05226   Gastric cancer cpoc05230   Central carbon metabolism in cancer cpoc05417   Lipid and atherosclerosis cpoc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100379269 (Tp53)    04310 Wnt signaling pathway     100379269 (Tp53)    04071 Sphingolipid signaling pathway     100379269 (Tp53)    04151 PI3K-Akt signaling pathway     100379269 (Tp53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100379269 (Tp53)   09143 Cell growth and death    04110 Cell cycle     100379269 (Tp53)    04210 Apoptosis     100379269 (Tp53)    04216 Ferroptosis     100379269 (Tp53)    04115 p53 signaling pathway     100379269 (Tp53)    04218 Cellular senescence     100379269 (Tp53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100379269 (Tp53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100379269 (Tp53)   09149 Aging    04211 Longevity regulating pathway     100379269 (Tp53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100379269 (Tp53)    05202 Transcriptional misregulation in cancer     100379269 (Tp53)    05206 MicroRNAs in cancer     100379269 (Tp53)    05205 Proteoglycans in cancer     100379269 (Tp53)    05203 Viral carcinogenesis     100379269 (Tp53)    05230 Central carbon metabolism in cancer     100379269 (Tp53)   09162 Cancer: specific types    05210 Colorectal cancer     100379269 (Tp53)    05212 Pancreatic cancer     100379269 (Tp53)    05225 Hepatocellular carcinoma     100379269 (Tp53)    05226 Gastric cancer     100379269 (Tp53)    05214 Glioma     100379269 (Tp53)    05216 Thyroid cancer     100379269 (Tp53)    05220 Chronic myeloid leukemia     100379269 (Tp53)    05217 Basal cell carcinoma     100379269 (Tp53)    05218 Melanoma     100379269 (Tp53)    05219 Bladder cancer     100379269 (Tp53)    05215 Prostate cancer     100379269 (Tp53)    05213 Endometrial cancer     100379269 (Tp53)    05224 Breast cancer     100379269 (Tp53)    05222 Small cell lung cancer     100379269 (Tp53)    05223 Non-small cell lung cancer     100379269 (Tp53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100379269 (Tp53)    05161 Hepatitis B     100379269 (Tp53)    05160 Hepatitis C     100379269 (Tp53)    05162 Measles     100379269 (Tp53)    05168 Herpes simplex virus 1 infection     100379269 (Tp53)    05163 Human cytomegalovirus infection     100379269 (Tp53)    05167 Kaposi sarcoma-associated herpesvirus infection     100379269 (Tp53)    05169 Epstein-Barr virus infection     100379269 (Tp53)    05165 Human papillomavirus infection     100379269 (Tp53)   09164 Neurodegenerative disease    05012 Parkinson disease     100379269 (Tp53)    05014 Amyotrophic lateral sclerosis     100379269 (Tp53)    05016 Huntington disease     100379269 (Tp53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100379269 (Tp53)    05418 Fluid shear stress and atherosclerosis     100379269 (Tp53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100379269 (Tp53)    01522 Endocrine resistance     100379269 (Tp53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cpoc03000]     100379269 (Tp53)    03036 Chromosome and associated proteins [BR:cpoc03036]     100379269 (Tp53)    03400 DNA repair and recombination proteins [BR:cpoc03400]     100379269 (Tp53) Transcription factors [BR:cpoc03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100379269 (Tp53) Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100379269 (Tp53) DNA repair and recombination proteins [BR:cpoc03400]  Eukaryotic type   Check point factors    Other check point factors     100379269 (Tp53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD TAD2 Motif Other DBs NCBI-GeneID:  100379269 NCBI-ProteinID:  NP_001166211 Ensembl:  ENSCPOG00000014252 UniProt:  Q9WUR6 LinkDB All DBs AA seq 391 aa AA seqDB search MEEPHSDLSIEPPLSQETFSDLWKLLPENNVLSDSLSPPMDHLLLSPEEVASWLGENPDG DGHVSAAPVSEAPTSAGPALVAPAPATSWPLSSSVPSHKPYRGSYGFEVHFLKSGTAKSV TCTYSPGLNKLFCQLAKTCPVQVWVESPPPPGTRVRALAIYKKSQHMTEVVRRCPHHERC SDSDGLAPPQHLIRVEGNLHAEYVDDRTTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSC MGGMNRRPILTIITLEDSSGKLLGRDSFEVRVCACPGRDRRTEEENFRKKGGLCPEPTPG NIKRALPTSTSSSPQPKKKPLDAEYFTLKIRGRKNFEILREINEALEFKDAQTEKEPGES RPHSSYPKSKKGQSTSCHKKLMFKREGLDSD NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt atggaggagccacactcggacctcagcatcgagcctccactgagtcaagaaacattttca gacttatggaaactacttcctgaaaacaacgttctgtcggactcactgtcccctcccatg gaccatcttctgctgtccccagaagaggttgcaagctggctgggagaaaacccggatgga gatggccatgtgtcagcagctcctgtatcagaggccccaacatcagcaggccctgccctg gtggcccctgcaccagctacttcctggcctctgtcatcctcagtcccttcccataagcca taccgtggcagctatggtttcgaggtgcacttccttaagtctgggacagccaagtctgtc acatgcacgtactcccctggcctcaacaagctcttctgccagctggcaaagacctgtcct gtgcaagtatgggtggaatcaccacccccacctggcacccgagtccgtgccctggccatc tacaagaagtcacagcacatgacggaggtggtgagacgctgcccccatcacgagcgctgt tccgatagtgatggcctggcccctcctcagcatctcatccgggtggaaggaaatctgcac gcagaatacgtggatgacagaaccactttccgccacagcgtggtggtgccctatgaaccg cctgaggtcggctccgactgcaccaccatccactacaactacatgtgcaacagctcctgc atgggaggcatgaaccggaggcccatcctcaccatcatcacgctggaagactccagtggg aaactgttgggtcgagacagctttgaggtacgtgtttgtgcctgtcctggaagagatcgg cgcacagaggaggaaaatttccgcaagaaaggaggcctgtgccctgagccaacaccagga aacattaagcgagccctgcccaccagcaccagctcctctccacagccaaagaagaaacca ctggatgcagaatacttcacccttaagatccgtgggcgtaaaaacttcgagatactccga gagataaacgaggccttggaattcaaggatgcccaaactgagaaggagccgggggagagc aggcctcactcgagctacccgaaatccaagaaggggcagtctacctcctgtcacaaaaaa ctgatgttcaagagagaaggactcgattcagactga

DBGET integrated database retrieval system