Cavia porcellus (domestic guinea pig): 100713271 Help Entry 100713271         CDS       T07777                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04010   MAPK signaling pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04024   cAMP signaling pathway cpoc04062   Chemokine signaling pathway cpoc04510   Focal adhesion cpoc04520   Adherens junction cpoc04611   Platelet activation cpoc04670   Leukocyte transendothelial migration cpoc04720   Long-term potentiation cpoc04722   Neurotrophin signaling pathway cpoc04934   Cushing syndrome cpoc04972   Pancreatic secretion cpoc05211   Renal cell carcinoma cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100713271    04014 Ras signaling pathway     100713271    04015 Rap1 signaling pathway     100713271    04024 cAMP signaling pathway     100713271  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     100713271    04520 Adherens junction     100713271  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100713271    04670 Leukocyte transendothelial migration     100713271    04062 Chemokine signaling pathway     100713271   09154 Digestive system    04972 Pancreatic secretion     100713271   09156 Nervous system    04720 Long-term potentiation     100713271    04722 Neurotrophin signaling pathway     100713271  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     100713271   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100713271   09167 Endocrine and metabolic disease    04934 Cushing syndrome     100713271  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cpoc04147]     100713271    04031 GTP-binding proteins [BR:cpoc04031]     100713271 Exosome [BR:cpoc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100713271   Exosomal proteins of other body fluids (saliva and urine)    100713271   Exosomal proteins of colorectal cancer cells    100713271 GTP-binding proteins [BR:cpoc04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     100713271 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Antigen_C Motif Other DBs NCBI-GeneID:  100713271 NCBI-ProteinID:  XP_005002382 Ensembl:  ENSCPOG00000039058 UniProt:  A0A286XDN6 LinkDB All DBs Position Unknown AA seq 165 aa AA seqDB search MPKYKPVVLGLGGIRKPAPPVQFVQRIFVEKYEPKREDSYRKMEQFIAMRDLYMKNGEGF ALVYSIIAESTFDDLQDLREQFLQVKDTEDVPMILVGNKCGLGDEKVVGKEQGQNLARQW NNCAFLESAKQKIYVNEIFCDLVQQIKGKTSVPGKTCNKSSYQLL NT seq 498 nt NT seq  +upstreamnt  +downstreamnt atgcctaagtataagccagttgttcttggcttaggaggcattagaaagcctgctccgcct gtacagtttgttcaaagaatttttgttgaaaaatatgaacccaagagagaagattcttat agaaaaatggaacaatttatagcaatgagagatttgtacatgaaaaatggagaaggcttt gctttagtttattccatcatagcagagtccacatttgatgatctacaagatctgagagaa cagtttcttcaggttaaagacactgaggatgttccaatgattctggttggtaataaatgt ggcttgggagatgaaaaagttgtaggaaaggaacaaggtcaaaatctagcaagacagtgg aacaactgtgcattcttagaatctgcaaaacaaaaaatatatgttaatgagatcttttgt gatctagtgcagcaaattaaaggaaaaacttcagtgcctgggaagacctgcaataagtcg tcatatcaactgctttaa

DBGET integrated database retrieval system