Cavia porcellus (domestic guinea pig): 100715309 Help Entry 100715309         CDS       T07777                                  Symbol Cd209 Name (RefSeq) CD209 antigen   KO K06563   C-type lectin domain family 4 member L/M Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03260   Virion - Human immunodeficiency virus cpoc03264   Virion - Flavivirus and Alphavirus cpoc03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus cpoc03273   Virion - Lassa virus and SFTS virus cpoc04145   Phagosome cpoc04517   IgSF CAM signaling cpoc04625   C-type lectin receptor signaling pathway cpoc05152   Tuberculosis cpoc05162   Measles Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     100715309 (Cd209)    03264 Virion - Flavivirus and Alphavirus     100715309 (Cd209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     100715309 (Cd209)    03273 Virion - Lassa virus and SFTS virus     100715309 (Cd209)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100715309 (Cd209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100715309 (Cd209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100715309 (Cd209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     100715309 (Cd209)   09171 Infectious disease: bacterial    05152 Tuberculosis     100715309 (Cd209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100715309 (Cd209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:cpoc04054]     100715309 (Cd209)    04515 Cell adhesion molecules [BR:cpoc04515]     100715309 (Cd209)    04090 CD molecules [BR:cpoc04090]     100715309 (Cd209)    04091 Lectins [BR:cpoc04091]     100715309 (Cd209) Membrane trafficking [BR:cpoc04131]  Endocytosis   Phagocytosis    C-lectin receptors     100715309 (Cd209) Pattern recognition receptors [BR:cpoc04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    100715309 (Cd209) Cell adhesion molecules [BR:cpoc04515]  Lectins   Selectins and C-type lectins    100715309 (Cd209) CD molecules [BR:cpoc04090]  Proteins   100715309 (Cd209) Lectins [BR:cpoc04091]  C-Type lectins   Asialoglycoprotein and DC receptors    100715309 (Cd209) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C PilO_N Clec-141-158 Chordopox_A33R C3orf85_N Motif Other DBs NCBI-GeneID:  100715309 NCBI-ProteinID:  XP_013006400 Ensembl:  ENSCPOG00000038706 UniProt:  A0A286XJQ8 LinkDB All DBs Position Unknown AA seq 241 aa AA seqDB search MGSSEESKAQQLGPLDEEELITSGPRSFMRGLGWQRISGFNCSAGYLGNDSIPLALQLLA LTLLAGLLVAILVQVSKSPSFRELEQEQSKQEKIYQELNKLKAGVDRLCRPCPWDWTLFQ EKCYFFSKSQRNWNDSSTTCKEKGAQLVIVDSDEEQSFLQMASKSKGRTWMGLSDLNMES KWHWVDGSLLSLSLMKYWNPNEPNNLGEEDCAEFAGDGWNDARCEVQKYFICEQSAASCS S NT seq 726 nt NT seq  +upstreamnt  +downstreamnt atgggcagttccgaggaatctaaggcgcagcagctgggtcccctggatgaagaagagctg ataaccagcggccccagaagtttcatgagaggcttaggctggcaacgaatttctggattc aactgctctgcagggtatctgggcaatgactccatccccctggccctacagctgctcgcc ctcacattactggctggactcctggtggccatccttgtccaagtctccaaaagccctagc ttccgggaactggagcaggagcagtcaaagcaggagaagatctaccaggaactcaacaag ctgaaggctggagtagaccgcctgtgccggccctgcccttgggactggacgctcttccaa gaaaagtgctacttcttctccaagtcacagcggaactggaatgactcgagcaccacctgc aaggaaaaaggggctcagctggtcatcgtagacagtgatgaggagcagagcttcctacag atggcttctaagagcaaaggccgcacctggatgggactgtcagacctgaacatggaatcc aagtggcactgggtggatgggtcgcttctgtcactcagcttaatgaaatactggaaccca aatgagcccaacaacttgggggaggaagactgcgcagaatttgccggcgatggctggaat gacgccagatgcgaggtccagaaatacttcatctgtgagcagtcggcagcttcctgctcc agctga

DBGET integrated database retrieval system