Cavia porcellus (domestic guinea pig): 100716160 Help Entry 100716160         CDS       T07777                                  Name (RefSeq) CD209 antigen-like protein E   KO K06563   C-type lectin domain family 4 member L/M Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03260   Virion - Human immunodeficiency virus cpoc03264   Virion - Flavivirus and Alphavirus cpoc03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus cpoc03273   Virion - Lassa virus and SFTS virus cpoc04145   Phagosome cpoc04517   IgSF CAM signaling cpoc04625   C-type lectin receptor signaling pathway cpoc05152   Tuberculosis cpoc05162   Measles Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     100716160    03264 Virion - Flavivirus and Alphavirus     100716160    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     100716160    03273 Virion - Lassa virus and SFTS virus     100716160  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100716160  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100716160  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100716160  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     100716160   09171 Infectious disease: bacterial    05152 Tuberculosis     100716160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100716160   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:cpoc04054]     100716160    04515 Cell adhesion molecules [BR:cpoc04515]     100716160    04090 CD molecules [BR:cpoc04090]     100716160    04091 Lectins [BR:cpoc04091]     100716160 Membrane trafficking [BR:cpoc04131]  Endocytosis   Phagocytosis    C-lectin receptors     100716160 Pattern recognition receptors [BR:cpoc04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    100716160 Cell adhesion molecules [BR:cpoc04515]  Lectins   Selectins and C-type lectins    100716160 CD molecules [BR:cpoc04090]  Proteins   100716160 Lectins [BR:cpoc04091]  C-Type lectins   Asialoglycoprotein and DC receptors    100716160 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  100716160 NCBI-ProteinID:  XP_003468241 LinkDB All DBs Position Unknown AA seq 242 aa AA seqDB search MAVPETAQAQKPGYLDEEQLISSRPSYAISGSGYRLASVLNSLAGCHLHHPIPLVLKLLL LTVFSGILVAILAQVFSIPSRQEYEQDQLQRKQFYKEIAQMKDTINNLCRPCSWDWTFFQ GKCYFFSKSQKSWHDSITACKEEGAELVIVESAEEQSFLQQTSKSKGIMWMGLSDLNKEG TWHWVDGSPLSGSFADYWNKGEPNNVGGEDCAEFKDDGWNDSRCENANFWICKKTAKSCS QN NT seq 729 nt NT seq  +upstreamnt  +downstreamnt atggctgtccctgagacggcacaggcacagaagcctggctatctggatgaggaacagctg ataagtagcagacccagctatgctatcagtggatctggataccgactggcttctgtgctc aacagccttgcaggctgtcacctccaccaccccattcccctggtcctgaagctgctctta ctcacagtcttctctgggatcttggtggccatccttgcccaagtcttcagtatccccagc aggcaggagtatgagcaggaccagttacagcggaagcagttctacaaggaaattgctcag atgaaggacacaataaacaacctgtgccgtccctgctcctgggactggacattcttccaa ggaaaatgctacttcttctccaagtcacagaagagctggcatgactcgattactgcctgc aaggaagaaggggctgaactggtcatcgtagagagtgctgaggagcagagcttcctgcag cagacctcaaaaagcaaaggcatcatgtggatggggctctcagacttgaataaagaaggc acatggcactgggtggatggctcgcctctgtcaggcagctttgcagactactggaataaa ggggagcccaacaatgttgggggggaagactgtgcggaattcaaggatgacggctggaat gacagcaggtgcgaaaacgccaatttctggatctgcaagaagactgcgaaatcttgctcc caaaactga

DBGET integrated database retrieval system