Cavia porcellus (domestic guinea pig): 100718960 Help Entry 100718960         CDS       T07777                                  Symbol Max Name (RefSeq) protein max isoform X5   KO K04453   Max protein Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03083   Polycomb repressive complex cpoc04010   MAPK signaling pathway cpoc05200   Pathways in cancer cpoc05202   Transcriptional misregulation in cancer cpoc05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     100718960 (Max)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100718960 (Max)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100718960 (Max)    05202 Transcriptional misregulation in cancer     100718960 (Max)   09162 Cancer: specific types    05222 Small cell lung cancer     100718960 (Max)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cpoc03000]     100718960 (Max)    03036 Chromosome and associated proteins [BR:cpoc03036]     100718960 (Max) Transcription factors [BR:cpoc03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     100718960 (Max) Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      100718960 (Max) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH Filament JetA bZIP_2 JAKMIP_CC3 SlyX Jnk-SapK_ap_N DUF5595 SLX9 GAGA_bind DUF4763 Csm1_N ATG16 Motif Other DBs NCBI-GeneID:  100718960 NCBI-ProteinID:  XP_003472562 Ensembl:  ENSCPOG00000038848 UniProt:  A0A286XSL3 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDS SLYTNSKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcagttccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagaatatatccagtacatgcgaaggaaaaaccacaca caccagcaagatattgatgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaagcgaggtcgagtgcccaactgcagaccaactacccctcctcagacagc agcctctacaccaactccaagggcagcaccatctctgccttcgatgggggctcggactcc agctcggagtcggagcccgaagagccccagagcaggaagaaactccggatggaggccagc taa

DBGET integrated database retrieval system