Cavia porcellus (domestic guinea pig): 100728135 Help Entry 100728135         CDS       T07777                                  Name (RefSeq) CD209 antigen-like protein C   KO K06563   C-type lectin domain family 4 member L/M Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03260   Virion - Human immunodeficiency virus cpoc03264   Virion - Flavivirus and Alphavirus cpoc03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus cpoc03273   Virion - Lassa virus and SFTS virus cpoc04145   Phagosome cpoc04517   IgSF CAM signaling cpoc04625   C-type lectin receptor signaling pathway cpoc05152   Tuberculosis cpoc05162   Measles Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     100728135    03264 Virion - Flavivirus and Alphavirus     100728135    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     100728135    03273 Virion - Lassa virus and SFTS virus     100728135  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     100728135  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100728135  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100728135  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     100728135   09171 Infectious disease: bacterial    05152 Tuberculosis     100728135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cpoc04131]     100728135   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:cpoc04054]     100728135    04515 Cell adhesion molecules [BR:cpoc04515]     100728135    04090 CD molecules [BR:cpoc04090]     100728135    04091 Lectins [BR:cpoc04091]     100728135 Membrane trafficking [BR:cpoc04131]  Endocytosis   Phagocytosis    C-lectin receptors     100728135 Pattern recognition receptors [BR:cpoc04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    100728135 Cell adhesion molecules [BR:cpoc04515]  Lectins   Selectins and C-type lectins    100728135 CD molecules [BR:cpoc04090]  Proteins   100728135 Lectins [BR:cpoc04091]  C-Type lectins   Asialoglycoprotein and DC receptors    100728135 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  100728135 NCBI-ProteinID:  XP_013005961 LinkDB All DBs Position Unknown AA seq 235 aa AA seqDB search MDIWKEVREEELAALGRRWMVVKLSLGQHEPGTGDQKTSILLLRGCLGHSPILLLLQLLS LILLTGLLVAILVPAPRIARTQQQETMNQEISQLKVRLAHLCRPCSWDWTLFQGNCYFFS KSLKNWTDSVTACEEMEAQLVIIESDEEQRFLLETSKKNGLTWIGLSDRKEEGAWSWMDD SPLLYKFSMYWLEGEPNNIEEEDCAELKGDGWNDNKCELHKFWICKKPEISCPHK NT seq 708 nt NT seq  +upstreamnt  +downstreamnt atggacatctggaaggaagtgagggaagaggagctggcagctctggggaggaggtggatg gtggtcaaactttccctgggccagcatgagccagggactggcgaccagaagacatcgatc ctccttcttagagggtgcctgggccacagtccaatcctcctgctcctgcagctgctctct ctcattctcctcactgggctcctggtggccatccttgtcccagcaccccggattgctagg acccagcagcaggagaccatgaaccaggaaatatcccagctgaaagttagattagcccac ctgtgccggccctgctcctgggattggacactcttccaaggaaactgttacttcttctcc aaatccctaaagaactggacagactctgtgactgcctgtgaagagatggaggctcaactt gtcattatcgaaagtgacgaggagcagcgcttccttctggagacttctaagaagaatggc ttaacctggataggactctcggaccggaaggaggaaggagcatggagttggatggatgat tctcctctgctgtacaagttcagcatgtattggctagaaggggagcccaacaatatcgag gaggaagactgtgcagaattaaaaggcgatggctggaatgacaacaaatgtgaattacac aaattctggatctgcaagaagcctgaaatctcctgcccccacaagtga

DBGET integrated database retrieval system