Cavia porcellus (domestic guinea pig): 100731713 Help Entry 100731713         CDS       T07777                                  Symbol Actg1 Name (RefSeq) actin, cytoplasmic 2   KO K05692   actin beta/gamma 1 Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03082   ATP-dependent chromatin remodeling cpoc04015   Rap1 signaling pathway cpoc04145   Phagosome cpoc04210   Apoptosis cpoc04390   Hippo signaling pathway cpoc04510   Focal adhesion cpoc04520   Adherens junction cpoc04530   Tight junction cpoc04611   Platelet activation cpoc04613   Neutrophil extracellular trap formation cpoc04670   Leukocyte transendothelial migration cpoc04714   Thermogenesis cpoc04810   Regulation of actin cytoskeleton cpoc04814   Motor proteins cpoc04820   Cytoskeleton in muscle cells cpoc04919   Thyroid hormone signaling pathway cpoc04921   Oxytocin signaling pathway cpoc04971   Gastric acid secretion cpoc05014   Amyotrophic lateral sclerosis cpoc05100   Bacterial invasion of epithelial cells cpoc05132   Salmonella infection cpoc05135   Yersinia infection cpoc05164   Influenza A cpoc05205   Proteoglycans in cancer cpoc05225   Hepatocellular carcinoma cpoc05410   Hypertrophic cardiomyopathy cpoc05412   Arrhythmogenic right ventricular cardiomyopathy cpoc05414   Dilated cardiomyopathy cpoc05416   Viral myocarditis cpoc05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100731713 (Actg1)  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100731713 (Actg1)    04390 Hippo signaling pathway     100731713 (Actg1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100731713 (Actg1)   09143 Cell growth and death    04210 Apoptosis     100731713 (Actg1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100731713 (Actg1)    04520 Adherens junction     100731713 (Actg1)    04530 Tight junction     100731713 (Actg1)   09142 Cell motility    04814 Motor proteins     100731713 (Actg1)    04820 Cytoskeleton in muscle cells     100731713 (Actg1)    04810 Regulation of actin cytoskeleton     100731713 (Actg1)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100731713 (Actg1)    04613 Neutrophil extracellular trap formation     100731713 (Actg1)    04670 Leukocyte transendothelial migration     100731713 (Actg1)   09152 Endocrine system    04921 Oxytocin signaling pathway     100731713 (Actg1)    04919 Thyroid hormone signaling pathway     100731713 (Actg1)   09154 Digestive system    04971 Gastric acid secretion     100731713 (Actg1)   09159 Environmental adaptation    04714 Thermogenesis     100731713 (Actg1)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100731713 (Actg1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100731713 (Actg1)   09172 Infectious disease: viral    05164 Influenza A     100731713 (Actg1)   09171 Infectious disease: bacterial    05132 Salmonella infection     100731713 (Actg1)    05135 Yersinia infection     100731713 (Actg1)    05100 Bacterial invasion of epithelial cells     100731713 (Actg1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100731713 (Actg1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100731713 (Actg1)    05410 Hypertrophic cardiomyopathy     100731713 (Actg1)    05412 Arrhythmogenic right ventricular cardiomyopathy     100731713 (Actg1)    05414 Dilated cardiomyopathy     100731713 (Actg1)    05416 Viral myocarditis     100731713 (Actg1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:cpoc03021]     100731713 (Actg1)    03019 Messenger RNA biogenesis [BR:cpoc03019]     100731713 (Actg1)    03036 Chromosome and associated proteins [BR:cpoc03036]     100731713 (Actg1)    03029 Mitochondrial biogenesis [BR:cpoc03029]     100731713 (Actg1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cpoc04812]     100731713 (Actg1)    04147 Exosome [BR:cpoc04147]     100731713 (Actg1) Transcription machinery [BR:cpoc03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100731713 (Actg1) Messenger RNA biogenesis [BR:cpoc03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100731713 (Actg1) Chromosome and associated proteins [BR:cpoc03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100731713 (Actg1)     NuA4 complex      100731713 (Actg1)   Chromatin remodeling factors    BAF complex     100731713 (Actg1)    PBAF complex     100731713 (Actg1)    GBAF(ncBAF) complex     100731713 (Actg1)    SWR1 complex     100731713 (Actg1) Mitochondrial biogenesis [BR:cpoc03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100731713 (Actg1) Cytoskeleton proteins [BR:cpoc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100731713 (Actg1) Exosome [BR:cpoc04147]  Exosomal proteins   Proteins found in most exosomes    100731713 (Actg1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100731713 NCBI-ProteinID:  XP_003464851 Ensembl:  ENSCPOG00000012101 UniProt:  A0A286XYY5 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggaagaagaaatcgccgcgctcgtcattgacaatggctccggcatgtgcaaggctggc tttgccggcgacgatgcaccccgggctgtgttcccctccatcgtcggccgcccccgacat cagggtgtgatggtgggcatgggccagaaagattcctacgtgggcgacgaggcccagagc aagcgcggtatcctgaccctaaagtatcctatcgagcatggcattgtcaccaactgggac gacatggaaaagatctggcaccacaccttctacaacgagctgcgtgtggcccctgaggag cacccagtgctgctgacagaggcccccttgaaccccaaggccaacagagagaagatgact cagatcatgtttgagaccttcaacaccccggccatgtacgtggctatccaggctgtgctg tccctttatgcatctgggcgcaccactggtatcgtcatggactctggtgatggggtcacc cacacagtgcccatctacgagggctacgccctcccccacgccatcctgcgtctggacctg gctggccgggacctgacagactacctcatgaagatcctgacggagcgagggtacagcttc accaccacagctgagcgggagattgtccgggacatcaaggagaagctgtgctatgtcgct ctggactttgagcaggagatggccacagctgcgtcttcatcctctttggagaaaagttat gagctgcccgatggccaagtgatcaccattggcaatgagcgcttccggtgtccagaggcg ctcttccagccctctttccttggtatggagtcctgtggcatccacgagaccaccttcaat tccatcatgaagtgcgatgtggacatccgcaaggacctgtatgccaatacggtgctgtct ggtggcaccaccatgtacccgggcattgctgacaggatgcagaaggagatcacagccctg gcgcccagcaccatgaagatcaagatcatcgccccccctgagcgcaagtattccgtgtgg atcggtggctccatcttggcctccctgtctaccttccagcagatgtggatcagcaagcag gagtatgatgagtcaggcccctcgatcgtgcaccgcaaatgcttctag

DBGET integrated database retrieval system