Cavia porcellus (domestic guinea pig): 100734449 Help Entry 100734449         CDS       T07777                                  Name (RefSeq) interferon beta   KO K05415   interferon beta Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04151   PI3K-Akt signaling pathway cpoc04217   Necroptosis cpoc04380   Osteoclast differentiation cpoc04620   Toll-like receptor signaling pathway cpoc04621   NOD-like receptor signaling pathway cpoc04622   RIG-I-like receptor signaling pathway cpoc04623   Cytosolic DNA-sensing pathway cpoc04630   JAK-STAT signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04668   TNF signaling pathway cpoc04936   Alcoholic liver disease cpoc05135   Yersinia infection cpoc05142   Chagas disease cpoc05152   Tuberculosis cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05162   Measles cpoc05163   Human cytomegalovirus infection cpoc05164   Influenza A cpoc05165   Human papillomavirus infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05171   Coronavirus disease - COVID-19 cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100734449    04668 TNF signaling pathway     100734449    04151 PI3K-Akt signaling pathway     100734449   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100734449  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100734449  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100734449    04621 NOD-like receptor signaling pathway     100734449    04622 RIG-I-like receptor signaling pathway     100734449    04623 Cytosolic DNA-sensing pathway     100734449    04650 Natural killer cell mediated cytotoxicity     100734449   09158 Development and regeneration    04380 Osteoclast differentiation     100734449  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100734449    05161 Hepatitis B     100734449    05160 Hepatitis C     100734449    05171 Coronavirus disease - COVID-19     100734449    05164 Influenza A     100734449    05162 Measles     100734449    05168 Herpes simplex virus 1 infection     100734449    05163 Human cytomegalovirus infection     100734449    05167 Kaposi sarcoma-associated herpesvirus infection     100734449    05169 Epstein-Barr virus infection     100734449    05165 Human papillomavirus infection     100734449   09171 Infectious disease: bacterial    05135 Yersinia infection     100734449    05152 Tuberculosis     100734449   09174 Infectious disease: parasitic    05142 Chagas disease     100734449   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100734449   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100734449  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100734449 Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Interferons    100734449 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon YmgB Motif Other DBs NCBI-GeneID:  100734449 NCBI-ProteinID:  XP_003472287 Ensembl:  ENSCPOG00000008049 UniProt:  H0VYK7 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search MASRCILQIALLLSFTTSLSLSYDLLQLQQQQRSSNSACLKLLRQVKGKPEHCQQDRMDF KFPEEIKQPRPFQKEMAALVIQEMLQNIFVIIRKEFSTTVWNKTIVDDLLDKLHQQMDRL KSTILQERPEDTNMTTLRLKSYYWRISRYLTARENSICAWTVVQAELISKFPIINSLTDY FQD NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atggccagcaggtgtatcctccaaatcgctctcctgctgtccttcaccacatctctttcc ttaagctatgacttgcttcaactccagcaacaacaacgcagcagcaattcggcctgtctg aagcttctgaggcaggtgaaaggaaagcctgaacattgccagcaggacaggatggatttc aagtttccagaggagatcaagcaaccacgtccattccagaaagagatggctgctcttgtc atccaggagatgcttcagaacatctttgttattatcagaaaagaattctctactactgtg tggaataagaccattgtggatgacctccttgataaactccatcagcagatggatcgtctg aagtcaacaatcctgcaggaaagaccagaggacacaaacatgaccactctgcgcctaaag agctattactggaggatcagcaggtacctcactgccagggagaacagcatttgtgcctgg acagtagtccaagcagaactcatcagtaagtttcccatcattaacagtcttacagattac tttcaagactga

DBGET integrated database retrieval system