Cavia porcellus (domestic guinea pig): 100735273 Help Entry 100735273         CDS       T07777                                  Symbol Pole4 Name (RefSeq) DNA polymerase epsilon subunit 4   KO K03506   DNA polymerase epsilon subunit 4 [EC:2.7.7.7] Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc03030   DNA replication cpoc03410   Base excision repair cpoc03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:cpoc00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     100735273 (Pole4)    03410 Base excision repair     100735273 (Pole4)    03420 Nucleotide excision repair     100735273 (Pole4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cpoc03032]     100735273 (Pole4)    03400 DNA repair and recombination proteins [BR:cpoc03400]     100735273 (Pole4) Enzymes [BR:cpoc01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      100735273 (Pole4) DNA replication proteins [BR:cpoc03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     100735273 (Pole4) DNA repair and recombination proteins [BR:cpoc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       100735273 (Pole4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone TAF CENP-T_C Motif Other DBs NCBI-GeneID:  100735273 NCBI-ProteinID:  XP_003468956 Ensembl:  ENSCPOG00000036220 UniProt:  A0A286X864 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MAAAAAGSGTPREEEGPGGEVAASQPQAPTSGPGARLSRLPLARVKALVKADPDVTLAGQ EAIFVLARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcggcagcggctggaagcgggacaccccgggaggaggaggggcccggaggggaa gtagcagcctcgcaaccccaagccccgacgagtgggcccggggctcgtctctcgaggctg cctctggcgcgagtgaaggccttggtgaaggcggaccctgacgtgacgctagcaggacag gaagccatcttcgttctggcgcgagccgcggaactgtttgtggagaccattgcaaaagat gcctactgctgtgctcaacaaggaaagaggaaaaccctccagaggagagatttggataat gcaatagaagctgtggatgaatttgcttttctggaaggtactttggattga

DBGET integrated database retrieval system