Cavia porcellus (domestic guinea pig): 111757491 Help Entry 111757491         CDS       T07777                                  Symbol Ifnb1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04060   Cytokine-cytokine receptor interaction cpoc04151   PI3K-Akt signaling pathway cpoc04217   Necroptosis cpoc04380   Osteoclast differentiation cpoc04620   Toll-like receptor signaling pathway cpoc04621   NOD-like receptor signaling pathway cpoc04622   RIG-I-like receptor signaling pathway cpoc04623   Cytosolic DNA-sensing pathway cpoc04630   JAK-STAT signaling pathway cpoc04650   Natural killer cell mediated cytotoxicity cpoc04668   TNF signaling pathway cpoc04936   Alcoholic liver disease cpoc05135   Yersinia infection cpoc05142   Chagas disease cpoc05152   Tuberculosis cpoc05160   Hepatitis C cpoc05161   Hepatitis B cpoc05162   Measles cpoc05163   Human cytomegalovirus infection cpoc05164   Influenza A cpoc05165   Human papillomavirus infection cpoc05167   Kaposi sarcoma-associated herpesvirus infection cpoc05168   Herpes simplex virus 1 infection cpoc05169   Epstein-Barr virus infection cpoc05170   Human immunodeficiency virus 1 infection cpoc05171   Coronavirus disease - COVID-19 cpoc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     111757491 (Ifnb1)    04668 TNF signaling pathway     111757491 (Ifnb1)    04151 PI3K-Akt signaling pathway     111757491 (Ifnb1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     111757491 (Ifnb1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111757491 (Ifnb1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     111757491 (Ifnb1)    04621 NOD-like receptor signaling pathway     111757491 (Ifnb1)    04622 RIG-I-like receptor signaling pathway     111757491 (Ifnb1)    04623 Cytosolic DNA-sensing pathway     111757491 (Ifnb1)    04650 Natural killer cell mediated cytotoxicity     111757491 (Ifnb1)   09158 Development and regeneration    04380 Osteoclast differentiation     111757491 (Ifnb1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     111757491 (Ifnb1)    05161 Hepatitis B     111757491 (Ifnb1)    05160 Hepatitis C     111757491 (Ifnb1)    05171 Coronavirus disease - COVID-19     111757491 (Ifnb1)    05164 Influenza A     111757491 (Ifnb1)    05162 Measles     111757491 (Ifnb1)    05168 Herpes simplex virus 1 infection     111757491 (Ifnb1)    05163 Human cytomegalovirus infection     111757491 (Ifnb1)    05167 Kaposi sarcoma-associated herpesvirus infection     111757491 (Ifnb1)    05169 Epstein-Barr virus infection     111757491 (Ifnb1)    05165 Human papillomavirus infection     111757491 (Ifnb1)   09171 Infectious disease: bacterial    05135 Yersinia infection     111757491 (Ifnb1)    05152 Tuberculosis     111757491 (Ifnb1)   09174 Infectious disease: parasitic    05142 Chagas disease     111757491 (Ifnb1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     111757491 (Ifnb1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     111757491 (Ifnb1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     111757491 (Ifnb1) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Interferons    111757491 (Ifnb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon DUF7605 GIPC1_GH2 Motif Other DBs NCBI-GeneID:  111757491 NCBI-ProteinID:  XP_023421804 Ensembl:  ENSCPOG00000009732 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MASWYILQIALLLSFTTSLSLSYDLLQLQQQQQRSSLACLKLLRQVKGKPENCHQDRIDF KFPEEILQPQQFQKEKAALVIQEMLQNVLGIFRKNISTTVWNETIVENLTDELHQQMDHL KSTILQERLEDKNMTMRDTMTTLRLKSYYWRISKYLRAKKNSICAWTVVQAELIRNFSII NRLTNYFQD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccagctggtatatcctccaaatcgctctcctgctgtccttcaccacatctctttcc ttaagctacgacttgcttcaactccagcaacaacaacaacgcagcagtttggcctgtctg aaacttctgaggcaggtgaaaggaaagcctgaaaactgccaccaggacaggatcgatttc aagtttccagaagagatcttgcaaccacagcagttccagaaggagaaggctgctcttgtc atccaagagatgcttcagaacgtcttgggtattttcagaaaaaacatttccaccactgta tggaatgagaccattgtggagaacctcactgatgaactccatcagcaaatggatcatctg aagtcaacgatcctgcaggaaagactggaggacaaaaacatgaccatgagggataccatg accactctgcgtttgaagagctattactggaggatcagcaagtacctcagagccaagaag aacagcatttgtgcctggacagtagtccaggcagaactcatcaggaacttttccatcatt aacagacttacaaattacttccaagactga

DBGET integrated database retrieval system