Colwellia psychrerythraea: CPS_4340 Help Entry CPS_4340          CDS       T00258                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism cps  Colwellia psychrerythraea Pathway cps00790   Folate biosynthesis cps01100   Metabolic pathways cps01240   Biosynthesis of cofactors Module cps_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:cps00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CPS_4340 (folB) Enzymes [BR:cps01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CPS_4340 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CPS_4340 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CPS_4340 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB MgtE_N Motif Other DBs NCBI-ProteinID:  AAZ25552 UniProt:  Q47W33 LinkDB All DBs Position 4574057..4574428 Genome browser AA seq 123 aa AA seqDB search MDKVFIKGLSIQTTIGFFQWEKEIKQTLVIDLAMGWNTANAALNDELAKTLDYADISVAI ERFANDNPVDLIETLAERLASYLMTQYQIPWLKLFIGKPGAVHNAQTVGVEIERGTQAVE ISS NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atggataaggtgttcattaagggtttaagtatccaaaccaccattggtttttttcagtgg gaaaaagaaataaaacaaaccttggttattgatctggccatgggctggaacacggccaat gcagcactcaatgacgaactagccaaaacattggattatgccgatatctcagtcgctata gagcgctttgccaacgacaatcccgttgacttaattgagacgcttgctgagcgcttagcc agttatttaatgacacaataccaaatcccttggttaaagctattcattggcaaacctggc gcagttcataatgcccaaactgttggtgttgaaattgaacgtggcacgcaagctgttgag atatcctcttaa

DBGET integrated database retrieval system