Coniophora puteana: CONPUDRAFT_106740 Help Entry CONPUDRAFT_106740 CDS       T03134                                  Name (RefSeq) RING/U-box   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cput  Coniophora puteana Pathway cput03420   Nucleotide excision repair cput04111   Cell cycle - yeast cput04120   Ubiquitin mediated proteolysis cput04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cput00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     CONPUDRAFT_106740    04120 Ubiquitin mediated proteolysis     CONPUDRAFT_106740   09124 Replication and repair    03420 Nucleotide excision repair     CONPUDRAFT_106740  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     CONPUDRAFT_106740  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cput04121]     CONPUDRAFT_106740    03400 DNA repair and recombination proteins [BR:cput03400]     CONPUDRAFT_106740 Enzymes [BR:cput01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      CONPUDRAFT_106740 Ubiquitin system [BR:cput04121]  Ubiquitin ligases (E3)   UBL E3 ligases    CONPUDRAFT_106740   Multi subunit type E3    SCF complex     Ring finger protein      CONPUDRAFT_106740    Cul2 complex      CONPUDRAFT_106740    Cul3 complex      CONPUDRAFT_106740    Cul4 complex      CONPUDRAFT_106740    Cul7 complex      CONPUDRAFT_106740    Cul8 complex      CONPUDRAFT_106740    Cul9 complex      CONPUDRAFT_106740 DNA repair and recombination proteins [BR:cput03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       CONPUDRAFT_106740     TCR (transcription coupled repair) factors      Cul4-CSA complex       CONPUDRAFT_106740 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 Motif Other DBs NCBI-GeneID:  19198607 NCBI-ProteinID:  XP_007770337 JGI:  Conpu1_106740 UniProt:  A0A5M3MLZ5 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MADMDVDHPPAESAIKTKGDKQRFEVKKWNAVSLWAWDIVVENCAICRNHIMDLCIDCQA NQVSASTEECNAAWGICNHAFHFHCISRWLKTRNVCPLDNREWELQKYGR NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccgatatggacgttgaccatccccccgccgaatccgccatcaagacaaagggcgac aagcagcgattcgaagtaaagaagtggaatgctgtaagcctgtgggcatgggacatcgtc gtcgagaactgtgccatctgcaggaaccacatcatggatctctgcattgattgccaggca aaccaggtttcggcatcgacagaagagtgcaacgcagcctggggtatctgcaaccatgcc ttccacttccactgcatctcccgctggctcaagacccgcaacgtctgcccgcttgacaac cgcgagtgggagctccagaagtatggccggtaa

DBGET integrated database retrieval system