Chenopodium quinoa (quinoa): 110688077 Help Entry 110688077         CDS       T05764                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism cqi  Chenopodium quinoa (quinoa) Pathway cqi03420   Nucleotide excision repair cqi04120   Ubiquitin mediated proteolysis cqi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cqi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110688077    04120 Ubiquitin mediated proteolysis     110688077   09124 Replication and repair    03420 Nucleotide excision repair     110688077  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cqi04121]     110688077    03400 DNA repair and recombination proteins [BR:cqi03400]     110688077 Enzymes [BR:cqi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110688077 Ubiquitin system [BR:cqi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110688077   Multi subunit type E3    SCF complex     Ring finger protein      110688077    Cul2 complex      110688077    Cul3 complex      110688077    Cul4 complex      110688077    Cul7 complex      110688077    Cul8 complex      110688077    Cul9 complex      110688077 DNA repair and recombination proteins [BR:cqi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110688077     TCR (transcription coupled repair) factors      Cul4-CSA complex       110688077 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  110688077 NCBI-ProteinID:  XP_021720449 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDSDVVMVPAGEGSSAAGPSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHIMDLCIE CQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggattccgacgtagttatggttcccgccggcgaaggttccagcgccgccggcccttct tccaagaaacccaaacgtttcgagatcaaaaagtggaacgccgtcgctctttgggcttgg gatattgttgtcgacaattgtgctatttgtcgtaatcatattatggatctttgtattgaa tgccaagctaatcaagctagcgctacgagtgaggagtgcactgttgcctggggtgtctgc aaccatgccttccatttccactgcatcagccgttggttaaaaactcgacaagtctgcccg ttagataatagtgagtgggagtttcagaaatatggccattag

DBGET integrated database retrieval system