Magallana gigas (Pacific oyster): 136271196 Help Entry 136271196         CDS       T03920                                  Name (RefSeq) transmembrane protein 258-like   KO K26502   transmembrane protein 258 Organism crg  Magallana gigas (Pacific oyster) Pathway crg00510   N-Glycan biosynthesis crg00513   Various types of N-glycan biosynthesis crg04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:crg00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     136271196    00513 Various types of N-glycan biosynthesis     136271196  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     136271196 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 TctB DUF6512 TMEM141 DUF7027 DUF7318 Motif Other DBs NCBI-GeneID:  136271196 NCBI-ProteinID:  XP_065926719 LinkDB All DBs Position 9:complement(22033112..22036146) Genome browser AA seq 82 aa AA seqDB search MADMTVEMMSRYVSPINPAVFPHLTVVLLGIGIFFMAWFFVYEVTSNKFTRDLSKELLVS LVASVFMGFGVVFLLLWVGIYV NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggcagacatgacagtggagatgatgagtcggtacgtcagtcccataaacccggcggtg ttcccacacctgactgtcgtgctgctgggaatcggcatcttcttcatggcctggttcttt gtctatgaagtaacctccaacaaattcactcgggacctctccaaggagctcctggtctct ctggtcgcctcggtgtttatgggctttggtgtggtcttcttattgctgtgggttgggatt tatgtatag

DBGET integrated database retrieval system