KEGG   Citrobacter rodentium: ROD_12181
Entry
ROD_12181         CDS       T01145                                 
Symbol
phoQ
Name
(GenBank) two-component sensor kinase
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_12181 (phoQ)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_12181 (phoQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cro01001]
    ROD_12181 (phoQ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_12181 (phoQ)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_12181 (phoQ)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ROD_12181 (phoQ)
Protein kinases [BR:cro01001]
 Histidine kinases
  OmpR family
   ROD_12181 (phoQ)
Two-component system [BR:cro02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   ROD_12181 (phoQ)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    ROD_12181 (phoQ)
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HATPase_c_2 HisKA HATPase_c_3 OmpH
Other DBs
NCBI-ProteinID: CBG87981
UniProt: D2TUC8
LinkDB
Position
complement(1321453..1322913)
AA seq 486 aa
MNKLLRHLFPLSLRLRFLLGTAGVVLVLSLAYGAVALVGYSVSFDKTTFRLLRGESNLFY
TLSKWEKQQIHVELPENLDMQSPTIALIYNENGKLLWAQRNVPWLVKLIQPDWLKSNGFH
EIEADIDATSTLLNDDHTIQEQLKEVREDDDDAEMTHSVAVNVYPATARMPQLTIVVVDT
IPVELKRSYMVWSWFIYVLAANLLLVIPLLWVAAWWSLRPIEALAREVRELEEHNREQLN
PETTRELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVLQSTLRSMRSEKLSV
SEAEPVMLEQISRISQQIGYYLHRANMRGGMLLSRELHPVAPLLDNLTSALNKVYQRKGV
TINLDISPEISFVGEQNDFVEVMGNVLDNACKYCLEFVEISARQTDDHLYIVVEDDGPGI
PQSMRDLVFDRGQRVDTLRPGQGVGLAVAREIAEQYDGRIIAGDSLLGGARMEVIFGRQQ
PGQKDG
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaataaactgttgcgtcatcttttcccgctctccctgcgcctgcgcttcctgctgggt
accgcgggggtggtgctggtgctctcgctggcctatggcgcggttgcgctggtgggctac
agcgtcagctttgataagaccacgtttcgcctgctgcgcggcgaaagtaacctgttttat
accctctcgaaatgggaaaagcagcagatccacgtcgagcttccggaaaatctcgacatg
caaagtcccaccatcgccctgatttacaacgaaaacggaaaactcctgtgggcccagcgc
aacgttccctggctggttaagcttattcagcctgactggctaaaaagcaacggctttcat
gaaatagaagcggatattgacgccaccagcaccctgctaaacgacgatcacacgattcag
gagcagttaaaagaggtgcgggaagatgacgacgatgcggaaatgacccactcggtggcg
gtgaacgtctatcccgcgacggcgcgtatgccgcagttgacgatcgtcgtggtcgatacc
atccccgttgagcttaaacgctcttatatggtctggagctggtttatctatgtgctggcg
gccaacctgctgctggtgattcccctgctgtgggtcgctgcctggtggagcctgcgcccg
atcgaagcgctggcgcgcgaagtgcgcgagctggaagaacacaatcgtgaacagctaaac
ccggaaaccacccgtgagctgaccagtctggtacgcaacctgaatcgcctgctgaagagc
gaacgcgaacgctacgacaaatatcgcaccacgcttaccgatcttacgcacagcctgaag
acgccgctggccgtgctgcaaagcacgctgcgttcaatgcgcagcgagaagttgagcgtc
agcgaagccgagccggttatgcttgagcagatcagccgtatttcccagcagatcggctat
tacctgcaccgcgccaatatgcgcggcggcatgctgctcagccgggaactacatccggtc
gcgccattgctcgataacctgacgtcggcgctgaacaaggtttaccagcgtaaaggcgtt
accatcaacctcgatatttcaccggaaatcagcttcgtcggcgaacaaaacgactttgtc
gaagtgatgggcaacgtgctggataacgcctgcaaatattgtctggagtttgtggagatc
tcggcgcgccagaccgacgatcatctgtacattgtggtggaagatgacgggccgggaatt
cctcaaagcatgcgcgatttggtgttcgatcgcggccagcgcgtggataccctgcggcca
ggccagggggtgggtctggcggttgccagggagatcgccgaacagtatgacggcagaatt
atcgctggcgacagtttactgggcggagcgcgtatggaggtcatttttggccgacagcag
ccggggcagaaggacggctaa

DBGET integrated database retrieval system