KEGG   Citrobacter rodentium: ROD_12191
Entry
ROD_12191         CDS       T01145                                 
Symbol
phoP
Name
(GenBank) two-component response regulator
  KO
K07660  two-component system, OmpR family, response regulator PhoP
Organism
cro  Citrobacter rodentium
Pathway
cro01503  Cationic antimicrobial peptide (CAMP) resistance
cro02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_12191 (phoP)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_12191 (phoP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:cro02022]
    ROD_12191 (phoP)
   01504 Antimicrobial resistance genes [BR:cro01504]
    ROD_12191 (phoP)
Two-component system [BR:cro02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   ROD_12191 (phoP)
Antimicrobial resistance genes [BR:cro01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    ROD_12191 (phoP)
SSDB
Motif
Pfam: Response_reg Trans_reg_C VpsR FleQ
Other DBs
NCBI-ProteinID: CBG87982
UniProt: D2TUC9
LinkDB
Position
complement(1322913..1323584)
AA seq 223 aa
MRVLVVEDNALLRHHLKVQLQDAGHQVDDAEDAKEADYYLNEHLPDIAIVDLGLPDEDGL
SLIRRWRGNDVSLPVLVLTAREGWQDKVEVLSAGADDYVTKPFHIEEVVARMQALMRRNS
GHASQIISIPPFQVDLSRRELSINDEVIKLTAFEYTIMETLIRNNGKVVSKDALMLQLYP
DAELRESHTIDVLMGRLRKKIQAQYPDDVITTVRGQGYLFELR
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcgcgttctggttgttgaggataatgcgttactacgtcaccacctgaaggtgcaactt
caggatgcgggacatcaggttgatgacgcggaagatgccaaagaggccgattattatctt
aacgagcatctgccagatatcgcgattgtcgatctcgggttaccggatgaagacggcctt
tccctgatccgccgctggcgcggcaatgacgtttctctgccggtgctggtgctcaccgcg
cgtgaaggctggcaggataaagtggaagtgctgagcgctggtgcggatgactacgtcact
aaacctttccatatcgaagaagtggtggcgcgcatgcaggcgctgatgcgtcgcaacagc
ggccatgcttcgcaaattatctctatcccgcccttccaggtcgatctctcgcgccgggag
ctgtcgatcaacgatgaggtgatcaaactgaccgcgttcgaatacaccattatggaaacg
ctgatccgtaataacggtaaagtggtcagtaaggacgccttgatgttacagctctacccg
gacgcagagctgcgggaaagccataccatcgatgtactgatggggcgtctgcgcaagaaa
attcaggcgcagtatccggacgatgtcattaccacggtgcgtggtcagggttatcttttt
gaactgcgctaa

DBGET integrated database retrieval system