KEGG   Citrobacter rodentium: ROD_42621
Entry
ROD_42621         CDS       T01145                                 
Symbol
eptb
Name
(GenBank) phosphoethanolamine transferase
  KO
K12975  KDO II ethanolaminephosphotransferase [EC:2.7.8.42]
Organism
cro  Citrobacter rodentium
Pathway
cro00540  Lipopolysaccharide biosynthesis
cro01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ROD_42621 (eptb)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ROD_42621 (eptb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:cro01005]
    ROD_42621 (eptb)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.42  Kdo2-lipid A phosphoethanolamine 7''-transferase
     ROD_42621 (eptb)
Lipopolysaccharide biosynthesis proteins [BR:cro01005]
 Lipid A
  ROD_42621 (eptb)
SSDB
Motif
Pfam: Sulfatase EptA_B_N Metalloenzyme FTR1
Other DBs
NCBI-ProteinID: CBG90960
UniProt: D2TJW1
LinkDB
Position
4495755..4497446
AA seq 563 aa
MKYIKSITQQKLSILLAVYIGLFMNGAVYFRRFDGYAQDFTVWNGVAAVVELAGTVLATF
FFLRLFSLFGRTVWRVLASLLVLISAGASYYMTFMNVMIGYGIVASVMTTDIDLSKEVVG
WTLILWVAGVSLIPLVMIWLNRSTDTFWRQLCTPKVRWRSALTVLMAALLVWAPIRLLEV
HQKRADRIAGVDMPSYGGVLANSYLPTNWLAALGLYAWAQVDESSDNKSLINPAKKFTYT
PTQNLDDTWVIFIIGETTRWDHMGMLGYERDTTPKLAKEKNLVMYRGYSCDTATKLSLRC
MFVRQGGAEDNPQRTLKEQNVFAVLKQLGFSSDLYAMQSEMWFYSNTMADNIAYREQIAA
EPRNRGKAVDDMLLVNEVDRSLENNSQGKHLIVLHTKGSHYNYTQRYPRAFAQWQPECYA
IDRKCPKDLMINSYDNSITYVDHFIDTVIDRVRDKKAIVFYAADHGESINEREHLHGTPR
KMAPPEQFRVPMMVWMSDKYLENPANAQAFAHLKKEAEMKVPRRHVELYDTIMGCLGYTS
PDGGINEHNNWCHIPDGQKAAAQ
NT seq 1692 nt   +upstreamnt  +downstreamnt
atgaaatacattaagtcgataacgcagcaaaagctaagcattttgcttgctgtctatatc
ggtctgtttatgaatggcgcggtctattttcgtcggtttgacggatatgcgcaggatttt
accgtatggaatggcgtcgccgcggtggtggaactggctggcacggtgctggcgaccttc
ttctttttacgtctcttttcgctgtttggccggacggtctggcgggttctggcgtcgctg
ctggtgctcatttcggcaggcgcaagctactacatgacctttatgaatgtcatgattggt
tacggtattgtagcctcggtgatgaccacggatatcgacctgtcaaaagaggtcgtcggc
tggacgcttatcctgtgggtggctggcgtgagcctcatcccgctggtgatgatctggctg
aatcgctcgacggataccttctggcgtcagctttgtacgccgaaagtccgctggcgcagc
gcgcttaccgtgctgatggcggctctgctggtgtgggcgccgattcgtctcctggaagta
caccagaagcgcgccgatcgcatcgccggggtggatatgccgagctacggcggcgtgctg
gcgaactcttatctgccgaccaactggcttgctgcgctgggtctgtatgcctgggcgcag
gttgatgaatcttctgataataagtcgctgattaacccggcgaagaagtttacctatacc
ccgacgcaaaaccttgatgacacctgggtgatttttattattggcgaaaccacccgttgg
gatcatatgggaatgctcggctatgagcgtgataccacgccgaagctggcgaaagagaag
aatctggtgatgtaccgcggctactcctgcgataccgccaccaaactgtcgctgcgctgc
atgttcgtgcgtcaggggggggcagaagataaccctcagcgcacgctgaaagagcagaac
gttttcgcggtgcttaagcagttaggctttagctccgatctgtatgcgatgcagagcgag
atgtggttctacagcaatacgatggccgacaacattgcctatcgcgaacaaattgccgcc
gagccgcgcaaccgcggtaaagccgtagatgatatgctgctggtgaatgaagttgaccgc
tcgctggagaataactcgcagggcaagcatcttatcgtgctgcataccaaaggttcccac
tataactatacccagcgttatccgcgcgcattcgcgcagtggcaaccggagtgctatgcc
atcgatcgtaagtgcccgaaggatctgatgatcaactcttacgataactctattacttac
gttgaccattttattgatacggtgattgatcgggttcgcgataagaaagcaattgtgttc
tatgcggcggatcatggtgagtcgatcaacgagcgtgagcacctgcacggcacgccgcgt
aaaatggcgccgccggagcagttccgcgtgccgatgatggtctggatgtcggataaatat
ttagagaatccggcaaacgctcaggcgtttgcgcatctgaagaaagaggcggaaatgaag
gtgccgcgccgtcacgttgagttgtacgacactattatgggctgtctcggctatacctcg
ccggacggcgggattaatgagcacaataactggtgtcatattcctgatggacagaaagcc
gccgcgcagtaa

DBGET integrated database retrieval system