Chlorocebus sabaeus (green monkey): 103215781 Help Entry 103215781         CDS       T04361                                  Symbol CXCL12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04064   NF-kappa B signaling pathway csab04360   Axon guidance csab04670   Leukocyte transendothelial migration csab04672   Intestinal immune network for IgA production csab04810   Regulation of actin cytoskeleton csab05163   Human cytomegalovirus infection csab05200   Pathways in cancer csab05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     103215781 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103215781 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     103215781 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103215781 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     103215781 (CXCL12)    04672 Intestinal immune network for IgA production     103215781 (CXCL12)    04062 Chemokine signaling pathway     103215781 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     103215781 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103215781 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103215781 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     103215781 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103215781 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103215781 (CXCL12) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103215781 (CXCL12) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Chemokines    103215781 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103215781 NCBI-ProteinID:  XP_007960674 Ensembl:  ENSCSAG00000010891 LinkDB All DBs Position 9:complement(40005580..40020513) Genome browser AA seq 119 aa AA seqDB search MNAKVVVVLALVLTTLCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgaacgccaaggtcgtggtcgtgctggccctcgtgctgaccacgctctgcctcagcgac gggaagcccgtcagcctgagctacagatgcccatgccgattcttcgaaagccatgttgcc agagccaacgtcaagcatctcaaaattctcaacactccgaactgtgcccttcagattgta gctcggctgaagaacaacaacagacaagtgtgcattgacccgaagctaaagtggattcag gagtacctggagaaagctttaaacaaggggcgcagagaagaaaaagtggggaaaaaagaa aagataggaaaaaagaagcgacagaagaagagaaaggctgcccagaaaaggaaaaactag

DBGET integrated database retrieval system