Chlorocebus sabaeus (green monkey): 103219383 Help Entry 103219383         CDS       T04361                                  Symbol IFNB1 Name (RefSeq) interferon beta 1   KO K05415   interferon beta Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04151   PI3K-Akt signaling pathway csab04217   Necroptosis csab04380   Osteoclast differentiation csab04620   Toll-like receptor signaling pathway csab04621   NOD-like receptor signaling pathway csab04622   RIG-I-like receptor signaling pathway csab04623   Cytosolic DNA-sensing pathway csab04630   JAK-STAT signaling pathway csab04650   Natural killer cell mediated cytotoxicity csab04668   TNF signaling pathway csab04936   Alcoholic liver disease csab05135   Yersinia infection csab05142   Chagas disease csab05152   Tuberculosis csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05168   Herpes simplex virus 1 infection csab05169   Epstein-Barr virus infection csab05170   Human immunodeficiency virus 1 infection csab05171   Coronavirus disease - COVID-19 csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103219383 (IFNB1)    04668 TNF signaling pathway     103219383 (IFNB1)    04151 PI3K-Akt signaling pathway     103219383 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103219383 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     103219383 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103219383 (IFNB1)    04621 NOD-like receptor signaling pathway     103219383 (IFNB1)    04622 RIG-I-like receptor signaling pathway     103219383 (IFNB1)    04623 Cytosolic DNA-sensing pathway     103219383 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     103219383 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     103219383 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103219383 (IFNB1)    05161 Hepatitis B     103219383 (IFNB1)    05160 Hepatitis C     103219383 (IFNB1)    05171 Coronavirus disease - COVID-19     103219383 (IFNB1)    05164 Influenza A     103219383 (IFNB1)    05162 Measles     103219383 (IFNB1)    05168 Herpes simplex virus 1 infection     103219383 (IFNB1)    05163 Human cytomegalovirus infection     103219383 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     103219383 (IFNB1)    05169 Epstein-Barr virus infection     103219383 (IFNB1)    05165 Human papillomavirus infection     103219383 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     103219383 (IFNB1)    05152 Tuberculosis     103219383 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     103219383 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103219383 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103219383 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103219383 (IFNB1) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Interferons    103219383 (IFNB1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  103219383 NCBI-ProteinID:  XP_007967306 Ensembl:  ENSCSAG00000000432 UniProt:  A0A0D9S9N2 LinkDB All DBs Position 12:58705158..58707473 Genome browser AA seq 187 aa AA seqDB search MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSSFQCQKLLWQLNGSLEYCLKDRMNFD IPEEIKQPQQFQKEDAALTIYEMLQNIFAIFRQDLSSTGWNETIVEKLLANVYHQIDHLK TILEEKLEKEDFTRGKFMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFFFINK LTGYLRN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacggctctt tccatgagctacaacttgcttggattcctacaaagaagcagcagttttcagtgtcagaag ctcctgtggcaattgaatggaagtcttgaatattgcctcaaggacaggatgaactttgac atccctgaggaaattaagcagccgcagcagttccagaaggaggacgctgcattgaccatc tatgagatgctccagaacatctttgctattttcagacaagatttatctagcactggctgg aatgagactattgtggagaaactccttgctaatgtctatcatcagatagaccatctgaag acaatcctagaagaaaaactagaaaaagaagatttcaccaggggaaaattcatgagcagt ctgcacctgaaaagatactatggaaggattctgcattacttgaaggccaaggagtacagt cactgtgcctggaccatagtcagagtggaaatcctcaggaactttttcttcattaacaaa cttacaggttacctccgaaactga

DBGET integrated database retrieval system