Chlorocebus sabaeus (green monkey): 103225463 Help Entry 103225463         CDS       T04361                                  Symbol PLA2G2D Name (RefSeq) phospholipase A2 group IID   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab00564   Glycerophospholipid metabolism csab00565   Ether lipid metabolism csab00590   Arachidonic acid metabolism csab00591   Linoleic acid metabolism csab00592   alpha-Linolenic acid metabolism csab01100   Metabolic pathways csab04014   Ras signaling pathway csab04270   Vascular smooth muscle contraction csab04972   Pancreatic secretion csab04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:csab00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     103225463 (PLA2G2D)    00565 Ether lipid metabolism     103225463 (PLA2G2D)    00590 Arachidonic acid metabolism     103225463 (PLA2G2D)    00591 Linoleic acid metabolism     103225463 (PLA2G2D)    00592 alpha-Linolenic acid metabolism     103225463 (PLA2G2D)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103225463 (PLA2G2D)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     103225463 (PLA2G2D)   09154 Digestive system    04972 Pancreatic secretion     103225463 (PLA2G2D)    04975 Fat digestion and absorption     103225463 (PLA2G2D)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csab03036]     103225463 (PLA2G2D) Enzymes [BR:csab01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      103225463 (PLA2G2D) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     103225463 (PLA2G2D) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  103225463 NCBI-ProteinID:  XP_007978416 Ensembl:  ENSCSAG00000000888 UniProt:  A0A0D9S8D0 LinkDB All DBs Position 20:112434208..112441215 Genome browser AA seq 161 aa AA seqDB search MERDFQQLPPLLSAGIMELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPLFFYWPY GCYCGPGGRGQPKDATDWCCQTHDCCYDHLKTHGCCVHTDHYRYSFSQGDIHCSDKGSWC EQQLCACDKEVALCLKRNLDTYKKRLRFYWRPRCQGQTPGC NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggaaagagacttccagcagctgcctccactgctgtctgctggcatcatggaacttgcc ctgctgtgtgggctggtggtgatggctggtgtgattccaatccagggcgggatcctgaac ctgaacaagatggtcaagcaagtgactgggaaaatgccccttttcttctactggccctac ggctgttactgcggaccaggtggcagaggccagcccaaagatgccacggactggtgctgt cagacccatgactgctgctacgaccacctgaagacccacggatgctgcgtccacacggac cactacagatacagcttttcccagggggacatccactgctctgacaagggaagctggtgt gagcagcagctgtgtgcctgtgacaaggaggtggccctctgcctgaagcgtaacctggac acctacaagaagcgactgcgtttctactggcggccccgctgccaggggcagacccctggg tgctag

DBGET integrated database retrieval system