Chlorocebus sabaeus (green monkey): 103225596 Help Entry 103225596         CDS       T04361                                  Symbol NPPA Name (RefSeq) natriuretic peptide A   KO K12334   natriuretic peptide A Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04022   cGMP-PKG signaling pathway csab04024   cAMP signaling pathway csab04066   HIF-1 signaling pathway csab04081   Hormone signaling csab04270   Vascular smooth muscle contraction csab04714   Thermogenesis csab04921   Oxytocin signaling pathway csab04923   Regulation of lipolysis in adipocytes csab04924   Renin secretion csab04925   Aldosterone synthesis and secretion csab05143   African trypanosomiasis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103225596 (NPPA)    04024 cAMP signaling pathway     103225596 (NPPA)    04022 cGMP-PKG signaling pathway     103225596 (NPPA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103225596 (NPPA)  09150 Organismal Systems   09152 Endocrine system    04923 Regulation of lipolysis in adipocytes     103225596 (NPPA)    04921 Oxytocin signaling pathway     103225596 (NPPA)    04924 Renin secretion     103225596 (NPPA)    04925 Aldosterone synthesis and secretion     103225596 (NPPA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103225596 (NPPA)   09159 Environmental adaptation    04714 Thermogenesis     103225596 (NPPA)  09160 Human Diseases   09174 Infectious disease: parasitic    05143 African trypanosomiasis     103225596 (NPPA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103225596 (NPPA) Cytokines and neuropeptides [BR:csab04052]  Neuropeptides   Unclassified    103225596 (NPPA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  103225596 NCBI-ProteinID:  XP_007978720 Ensembl:  ENSCSAG00000000802 UniProt:  A0A0D9S8L5 LinkDB All DBs Position 20:119942412..119946211 Genome browser AA seq 153 aa AA seqDB search MSSFSTISVSFLLFLAFQLPGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEIVPP QVLREQNEEAGAALSPLPEVPPWTGDISPAQRDGGALGQGPWDSSDRSALLKSKLRALLT APRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgagttccttctccaccatcagtgtgagcttcctcctttttctggcattccagctccca ggtcagaccagagctaatcccatgtacaatgccgtgtccaacgcagacctgatggatttc aagaatttgctggaccatttggaagaaaagatgcctttagaagatgagatcgtgccccca caagtgctcagagagcagaatgaagaagcgggggctgctctcagccccctccctgaggtg cctccctggaccggggacatcagcccagcccagagagatgggggtgccctcgggcagggc ccctgggactcctccgatcgatctgccctcttaaaaagcaagctgagggcactgctcact gcccctcggagcctgcggagatccagctgcttcgggggcaggatggacaggattggagcc cagagcggactgggctgtaacagcttccggtaccgaagataa

DBGET integrated database retrieval system