Chlorocebus sabaeus (green monkey): 103230190 Help Entry 103230190         CDS       T04361                                  Symbol IL10 Name (RefSeq) interleukin 10   KO K05443   interleukin 10 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04068   FoxO signaling pathway csab04148   Efferocytosis csab04625   C-type lectin receptor signaling pathway csab04630   JAK-STAT signaling pathway csab04660   T cell receptor signaling pathway csab04672   Intestinal immune network for IgA production csab05133   Pertussis csab05135   Yersinia infection csab05140   Leishmaniasis csab05142   Chagas disease csab05143   African trypanosomiasis csab05144   Malaria csab05145   Toxoplasmosis csab05146   Amoebiasis csab05150   Staphylococcus aureus infection csab05152   Tuberculosis csab05310   Asthma csab05320   Autoimmune thyroid disease csab05321   Inflammatory bowel disease csab05322   Systemic lupus erythematosus csab05330   Allograft rejection Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103230190 (IL10)    04068 FoxO signaling pathway     103230190 (IL10)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103230190 (IL10)    04061 Viral protein interaction with cytokine and cytokine receptor     103230190 (IL10)  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     103230190 (IL10)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103230190 (IL10)    04660 T cell receptor signaling pathway     103230190 (IL10)    04672 Intestinal immune network for IgA production     103230190 (IL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05135 Yersinia infection     103230190 (IL10)    05133 Pertussis     103230190 (IL10)    05150 Staphylococcus aureus infection     103230190 (IL10)    05152 Tuberculosis     103230190 (IL10)   09174 Infectious disease: parasitic    05146 Amoebiasis     103230190 (IL10)    05144 Malaria     103230190 (IL10)    05145 Toxoplasmosis     103230190 (IL10)    05140 Leishmaniasis     103230190 (IL10)    05142 Chagas disease     103230190 (IL10)    05143 African trypanosomiasis     103230190 (IL10)   09163 Immune disease    05310 Asthma     103230190 (IL10)    05322 Systemic lupus erythematosus     103230190 (IL10)    05320 Autoimmune thyroid disease     103230190 (IL10)    05321 Inflammatory bowel disease     103230190 (IL10)    05330 Allograft rejection     103230190 (IL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103230190 (IL10)    00536 Glycosaminoglycan binding proteins [BR:csab00536]     103230190 (IL10) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Interleukins    103230190 (IL10) Glycosaminoglycan binding proteins [BR:csab00536]  Heparan sulfate / Heparin   Cytokines    103230190 (IL10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL10 CLZ ALIX_LYPXL_bnd Motif Other DBs NCBI-GeneID:  103230190 NCBI-ProteinID:  XP_007986854 Ensembl:  ENSCSAG00000014965 LinkDB All DBs Position 25:22590389..22595877 Genome browser AA seq 199 aa AA seqDB search MHSSALLCCLVLLTGVRASPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQ LDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLR LRLRRCHRFLPCENKSKAVEQVKNAFSKVSLDGGREGLQSTTHAHSPPPKRGRWRGLSRP HPSLEGVWEPDRWYDLLSQ NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgcacagctcagcactgctctgttgcctggtcctcctgactggggtgagggccagccca ggccagggcactcagtctgagaacagctgcacccgcttcccaggcaacctgcctcacatg cttcgagacctccgagatgccttcagcagagtgaagactttctttcaaatgaaggatcag ctggacaacatattgttaaaggagtccttgctggaggactttaagggttacctgggttgc caagccttgtctgagatgatccagttttacctggaggaggtgatgccccaagctgagaac cacgacccagacatcaaggagcatgtgaactccctgggggagaatctgaagaccctcagg ctgaggctgcggcgctgtcatcgatttcttccctgtgaaaacaagagcaaggccgtggag caggtgaagaatgcctttagtaaggtgagcttggatggtggcagagagggtctgcagagc acaacccatgcccactccccacccccaaagcgtggaaggtggcggggactcagtaggccc catccttcattggaaggagtgtgggaacctgacagatggtatgacctgctcagccagtga

DBGET integrated database retrieval system