Chlorocebus sabaeus (green monkey): 103230577 Help Entry 103230577         CDS       T04361                                  Symbol FASLG Name (RefSeq) Fas ligand   KO K04389   tumor necrosis factor ligand superfamily member 6 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01524   Platinum drug resistance csab04010   MAPK signaling pathway csab04014   Ras signaling pathway csab04060   Cytokine-cytokine receptor interaction csab04068   FoxO signaling pathway csab04151   PI3K-Akt signaling pathway csab04210   Apoptosis csab04217   Necroptosis csab04650   Natural killer cell mediated cytotoxicity csab04722   Neurotrophin signaling pathway csab04932   Non-alcoholic fatty liver disease csab04936   Alcoholic liver disease csab04940   Type I diabetes mellitus csab05022   Pathways of neurodegeneration - multiple diseases csab05142   Chagas disease csab05143   African trypanosomiasis csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05168   Herpes simplex virus 1 infection csab05170   Human immunodeficiency virus 1 infection csab05200   Pathways in cancer csab05205   Proteoglycans in cancer csab05320   Autoimmune thyroid disease csab05330   Allograft rejection csab05332   Graft-versus-host disease csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103230577 (FASLG)    04014 Ras signaling pathway     103230577 (FASLG)    04068 FoxO signaling pathway     103230577 (FASLG)    04151 PI3K-Akt signaling pathway     103230577 (FASLG)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103230577 (FASLG)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103230577 (FASLG)    04217 Necroptosis     103230577 (FASLG)  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     103230577 (FASLG)   09156 Nervous system    04722 Neurotrophin signaling pathway     103230577 (FASLG)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103230577 (FASLG)    05205 Proteoglycans in cancer     103230577 (FASLG)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103230577 (FASLG)    05161 Hepatitis B     103230577 (FASLG)    05160 Hepatitis C     103230577 (FASLG)    05164 Influenza A     103230577 (FASLG)    05162 Measles     103230577 (FASLG)    05168 Herpes simplex virus 1 infection     103230577 (FASLG)    05163 Human cytomegalovirus infection     103230577 (FASLG)    05165 Human papillomavirus infection     103230577 (FASLG)   09174 Infectious disease: parasitic    05142 Chagas disease     103230577 (FASLG)    05143 African trypanosomiasis     103230577 (FASLG)   09163 Immune disease    05320 Autoimmune thyroid disease     103230577 (FASLG)    05330 Allograft rejection     103230577 (FASLG)    05332 Graft-versus-host disease     103230577 (FASLG)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     103230577 (FASLG)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103230577 (FASLG)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103230577 (FASLG)    04936 Alcoholic liver disease     103230577 (FASLG)    04932 Non-alcoholic fatty liver disease     103230577 (FASLG)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103230577 (FASLG)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:csab04147]     103230577 (FASLG)    04052 Cytokines and neuropeptides [BR:csab04052]     103230577 (FASLG)    04090 CD molecules [BR:csab04090]     103230577 (FASLG) Exosome [BR:csab04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103230577 (FASLG) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Tumor necrosis fators    103230577 (FASLG) CD molecules [BR:csab04090]  Proteins   103230577 (FASLG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  103230577 NCBI-ProteinID:  XP_007987680 Ensembl:  ENSCSAG00000011699 UniProt:  A0A0D9RGY9 LinkDB All DBs Position 25:complement(56488572..56496469) Genome browser AA seq 282 aa AA seqDB search MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPPPLPPPP PPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTS QRHTVSSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKG GLVINETGLYFVYSKVYFRGQSCTNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMW AHSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL NT seq 849 nt NT seq  +upstreamnt  +downstreamnt atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct ggtcaaaggaggccaccacctccgccgccgccgccgccacctccactaccacctccaccg ccgccaccactgcctccactaccgctgccacccttgaagaagaggggaaaccacagcaca ggcctgtgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggactg gggatgtttcagctcttccacctacagaaagagctggcagaactccgagagtctaccagc cagaggcatacagtatcatctttggagaaacaaataggtcaccccagtccaccccctgag aaaaaggagcagaggaaagtggcccatttaacaggcaagcccaactcaaggtccatgcct ctggaatgggaagacacctatggaattgtcctgctttctggagtgaaatataagaagggt ggccttgtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggt caatcttgcaccaacctgcccctgagccacaaggtctacatgaggaactctaagtatccc caggatctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgg gcccacagcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtc aatgtatctgagctctctctggtcaattttgaggaatctcagacattttttggcctatat aagctctaa

DBGET integrated database retrieval system