Chlorocebus sabaeus (green monkey): 103230823 Help Entry 103230823         CDS       T04361                                  Name (RefSeq) actin-like   KO K05692   actin beta/gamma 1 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab03082   ATP-dependent chromatin remodeling csab04015   Rap1 signaling pathway csab04145   Phagosome csab04210   Apoptosis csab04390   Hippo signaling pathway csab04510   Focal adhesion csab04520   Adherens junction csab04530   Tight junction csab04611   Platelet activation csab04613   Neutrophil extracellular trap formation csab04670   Leukocyte transendothelial migration csab04714   Thermogenesis csab04810   Regulation of actin cytoskeleton csab04814   Motor proteins csab04820   Cytoskeleton in muscle cells csab04919   Thyroid hormone signaling pathway csab04921   Oxytocin signaling pathway csab04971   Gastric acid secretion csab05014   Amyotrophic lateral sclerosis csab05100   Bacterial invasion of epithelial cells csab05132   Salmonella infection csab05135   Yersinia infection csab05164   Influenza A csab05205   Proteoglycans in cancer csab05225   Hepatocellular carcinoma csab05410   Hypertrophic cardiomyopathy csab05412   Arrhythmogenic right ventricular cardiomyopathy csab05414   Dilated cardiomyopathy csab05416   Viral myocarditis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     103230823  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103230823    04390 Hippo signaling pathway     103230823  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103230823   09143 Cell growth and death    04210 Apoptosis     103230823   09144 Cellular community - eukaryotes    04510 Focal adhesion     103230823    04520 Adherens junction     103230823    04530 Tight junction     103230823   09142 Cell motility    04814 Motor proteins     103230823    04820 Cytoskeleton in muscle cells     103230823    04810 Regulation of actin cytoskeleton     103230823  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103230823    04613 Neutrophil extracellular trap formation     103230823    04670 Leukocyte transendothelial migration     103230823   09152 Endocrine system    04921 Oxytocin signaling pathway     103230823    04919 Thyroid hormone signaling pathway     103230823   09154 Digestive system    04971 Gastric acid secretion     103230823   09159 Environmental adaptation    04714 Thermogenesis     103230823  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103230823   09162 Cancer: specific types    05225 Hepatocellular carcinoma     103230823   09172 Infectious disease: viral    05164 Influenza A     103230823   09171 Infectious disease: bacterial    05132 Salmonella infection     103230823    05135 Yersinia infection     103230823    05100 Bacterial invasion of epithelial cells     103230823   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103230823   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103230823    05410 Hypertrophic cardiomyopathy     103230823    05412 Arrhythmogenic right ventricular cardiomyopathy     103230823    05414 Dilated cardiomyopathy     103230823    05416 Viral myocarditis     103230823  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:csab03021]     103230823    03019 Messenger RNA biogenesis [BR:csab03019]     103230823    03036 Chromosome and associated proteins [BR:csab03036]     103230823    03029 Mitochondrial biogenesis [BR:csab03029]     103230823   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:csab04812]     103230823    04147 Exosome [BR:csab04147]     103230823 Transcription machinery [BR:csab03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      103230823 Messenger RNA biogenesis [BR:csab03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      103230823 Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      103230823     NuA4 complex      103230823   Chromatin remodeling factors    BAF complex     103230823    PBAF complex     103230823    GBAF(ncBAF) complex     103230823    SWR1 complex     103230823 Mitochondrial biogenesis [BR:csab03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     103230823 Cytoskeleton proteins [BR:csab04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      103230823 Exosome [BR:csab04147]  Exosomal proteins   Proteins found in most exosomes    103230823 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  103230823 NCBI-ProteinID:  XP_007988104 LinkDB All DBs Position 25:75043240..75044840 Genome browser AA seq 285 aa AA seqDB search MSKFSCCRQPVHCVLLLLHCRFPLPVTMEEEIAVLAIDNGSSMXKAGIAGDDAPQVIFPS IDRHPQHQGMMVGMGQKDSYVDDKAQSQHGIPTLKYPIEHGIVTNWDDMXKIWDHTFYNE LRVALEEHPVLLIETPPEPQANREKMTQIMFEIFNTPAMYLAIQAVLSLYTSGGTTGIVM DSGDRITHTVPMYMVYALPHTILHLDLADWDLTNYLMKILTKCGYGFTTSAQQEIMCHIR EKLCYVTSGLRQGEGHCHVLLLPGEELELPNGQVITIGNKRSRCH NT seq 858 nt NT seq  +upstreamnt  +downstreamnt atgtccaagttcagttgctgccgccagcctgttcactgtgttctcctgctgctccactgc cgctttcctctcccagtcacaatggaagaagagatcgctgtgcttgccattgacaatggc tccagcatgngcaaagctggcattgctggggacgatgccccccaagtcatatttccctcc attgacaggcacccccagcaccagggcatgatggtgggcatgggccagaaggactcctat gtggatgacaaggcccagagccagcacggcatcccgaccctgaagtaccccattgagcat ggcatcgtcaccaactgggatgacatgtagaagatctgggaccacaccttctacaatgag ctgcgtgtggccctggaggagcacccagtgctgctgatcgagaccccccctgaaccccaa gccaacagagagaagatgactcagatcatgtttgagatcttcaacaccccagccatgtac ttggccatccaggccgtgctgtccctctacacctctgggggcaccactggcattgtcatg gactctggagacaggatcacccacacggtgcccatgtacatggtatacgccctcccacac accatcctgcatctggacctggctgactgggacctgaccaactacctcatgaagatcctc accaagtgtggctacggcttcaccacctcggcccagcaggagatcatgtgccacatcagg gagaagctgtgctatgtcacttctggacttcgacaaggagagggccactgccatgtcctc ctcctccctggagaagagctagagctgcccaatggccaggtcatcaccatcggcaataaa cggtcccggtgccactaa

DBGET integrated database retrieval system