Chlorocebus sabaeus (green monkey): 103234205 Help Entry 103234205         CDS       T04361                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab00510   N-Glycan biosynthesis csab00513   Various types of N-glycan biosynthesis csab04141   Protein processing in endoplasmic reticulum Module csab_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:csab00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     103234205 (TMEM258)    00513 Various types of N-glycan biosynthesis     103234205 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103234205 (TMEM258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  103234205 NCBI-ProteinID:  XP_007994057 Ensembl:  ENSCSAG00000006457 UniProt:  A0A0D9R2A9 LinkDB All DBs Position 1:12062209..12065660 Genome browser AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccggctgtcttcccccat ctgactgtggtgcttttggccatcggcatgttcttcaccgcctggttcttcgtttatgag gtcacctctaccaagtacactcgtgatatctataaagagctcctcatctctttggtggcc tcactcttcatgggctttggagtccttttcctgctgctctgggttggcatctacgtgtga

DBGET integrated database retrieval system