Chlorocebus sabaeus (green monkey): 103235789 Help Entry 103235789         CDS       T04361                                  Symbol CXCL1 Name (RefSeq) C-X-C motif chemokine ligand 1   KO K05505   C-X-C motif chemokine 1/2/3 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab04060   Cytokine-cytokine receptor interaction csab04061   Viral protein interaction with cytokine and cytokine receptor csab04062   Chemokine signaling pathway csab04064   NF-kappa B signaling pathway csab04621   NOD-like receptor signaling pathway csab04657   IL-17 signaling pathway csab04668   TNF signaling pathway csab04936   Alcoholic liver disease csab05134   Legionellosis csab05146   Amoebiasis csab05167   Kaposi sarcoma-associated herpesvirus infection csab05323   Rheumatoid arthritis csab05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     103235789 (CXCL1)    04668 TNF signaling pathway     103235789 (CXCL1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103235789 (CXCL1)    04061 Viral protein interaction with cytokine and cytokine receptor     103235789 (CXCL1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103235789 (CXCL1)    04657 IL-17 signaling pathway     103235789 (CXCL1)    04062 Chemokine signaling pathway     103235789 (CXCL1)  09160 Human Diseases   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     103235789 (CXCL1)   09171 Infectious disease: bacterial    05134 Legionellosis     103235789 (CXCL1)   09174 Infectious disease: parasitic    05146 Amoebiasis     103235789 (CXCL1)   09163 Immune disease    05323 Rheumatoid arthritis     103235789 (CXCL1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103235789 (CXCL1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103235789 (CXCL1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:csab04052]     103235789 (CXCL1) Cytokines and neuropeptides [BR:csab04052]  Cytokines   Chemokines    103235789 (CXCL1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103235789 NCBI-ProteinID:  XP_007997066 Ensembl:  ENSCSAG00000004773 UniProt:  A0A0D9QXL0 LinkDB All DBs Position 7:22327041..22329405 Genome browser AA seq 107 aa AA seqDB search MARAALSAAPSNPRFLRVALLLLLLVATGRRAAGASVVTELRCQCLQTLQGIHPKNIQSV NVRAPGPHCAQIEVIATLKNGQKACLNPATPMVKKIIEKMLNCDKSN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgccgcgctctccgcagcccctagcaatccccggttcctgcgggtggcgctg ctgctcctgctcctggtggccaccggccggcgcgcagcaggagcgtccgtggtcactgaa ttgcgctgccagtgtttgcagaccctgcagggaattcaccccaagaatatccaaagtgtg aacgtgagggccccaggaccccactgcgcccaaatcgaagtcatagccacactcaagaat gggcagaaagcttgtctcaaccccgcaacccccatggttaagaaaatcatcgaaaagatg ctgaactgtgacaaatccaactga

DBGET integrated database retrieval system