Chlorocebus sabaeus (green monkey): 103238589 Help Entry 103238589         CDS       T04361                                  Symbol CDK4 Name (RefSeq) cyclin dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01522   Endocrine resistance csab04110   Cell cycle csab04115   p53 signaling pathway csab04151   PI3K-Akt signaling pathway csab04218   Cellular senescence csab04530   Tight junction csab04660   T cell receptor signaling pathway csab04933   AGE-RAGE signaling pathway in diabetic complications csab04934   Cushing syndrome csab05160   Hepatitis C csab05162   Measles csab05163   Human cytomegalovirus infection csab05164   Influenza A csab05165   Human papillomavirus infection csab05166   Human T-cell leukemia virus 1 infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05169   Epstein-Barr virus infection csab05200   Pathways in cancer csab05203   Viral carcinogenesis csab05212   Pancreatic cancer csab05214   Glioma csab05218   Melanoma csab05219   Bladder cancer csab05220   Chronic myeloid leukemia csab05222   Small cell lung cancer csab05223   Non-small cell lung cancer csab05224   Breast cancer csab05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     103238589 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     103238589 (CDK4)    04115 p53 signaling pathway     103238589 (CDK4)    04218 Cellular senescence     103238589 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     103238589 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     103238589 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103238589 (CDK4)    05203 Viral carcinogenesis     103238589 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     103238589 (CDK4)    05225 Hepatocellular carcinoma     103238589 (CDK4)    05214 Glioma     103238589 (CDK4)    05220 Chronic myeloid leukemia     103238589 (CDK4)    05218 Melanoma     103238589 (CDK4)    05219 Bladder cancer     103238589 (CDK4)    05224 Breast cancer     103238589 (CDK4)    05222 Small cell lung cancer     103238589 (CDK4)    05223 Non-small cell lung cancer     103238589 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103238589 (CDK4)    05160 Hepatitis C     103238589 (CDK4)    05164 Influenza A     103238589 (CDK4)    05162 Measles     103238589 (CDK4)    05163 Human cytomegalovirus infection     103238589 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     103238589 (CDK4)    05169 Epstein-Barr virus infection     103238589 (CDK4)    05165 Human papillomavirus infection     103238589 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103238589 (CDK4)    04934 Cushing syndrome     103238589 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103238589 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:csab01001]     103238589 (CDK4) Enzymes [BR:csab01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      103238589 (CDK4) Protein kinases [BR:csab01001]  Serine/threonine kinases: CMGC group   CDK family    103238589 (CDK4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  103238589 NCBI-ProteinID:  XP_008002030 Ensembl:  ENSCSAG00000004632 UniProt:  A0A0D9QX74 LinkDB All DBs Position 11:complement(53661877..53665688) Genome browser AA seq 303 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG NPE NT seq 912 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagta tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg aggcgactggaggcttttgaacatcccaatgtagtccggctgatggacgtctgtgccaca tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta aggacgtatctggacaaggcacccccaccaggcttgccagctgagaccatcaaggatttg atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat ctgaagccagagaacattctggtgacgagtggtggaacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacccgtggttgttactctctggtac cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt aatccggagtga

DBGET integrated database retrieval system