Chlorocebus sabaeus (green monkey): 103239247 Help Entry 103239247         CDS       T04361                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2 group IB   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab00564   Glycerophospholipid metabolism csab00565   Ether lipid metabolism csab00590   Arachidonic acid metabolism csab00591   Linoleic acid metabolism csab00592   alpha-Linolenic acid metabolism csab01100   Metabolic pathways csab04014   Ras signaling pathway csab04270   Vascular smooth muscle contraction csab04972   Pancreatic secretion csab04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:csab00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     103239247 (PLA2G1B)    00565 Ether lipid metabolism     103239247 (PLA2G1B)    00590 Arachidonic acid metabolism     103239247 (PLA2G1B)    00591 Linoleic acid metabolism     103239247 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     103239247 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103239247 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     103239247 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     103239247 (PLA2G1B)    04975 Fat digestion and absorption     103239247 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:csab03036]     103239247 (PLA2G1B) Enzymes [BR:csab01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      103239247 (PLA2G1B) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     103239247 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Phospholip_A2_4 Motif Other DBs NCBI-GeneID:  103239247 NCBI-ProteinID:  XP_008003124 Ensembl:  ENSCSAG00000002266 UniProt:  A0A0D9S4I0 LinkDB All DBs Position 11:complement(115670353..115677003) Genome browser AA seq 148 aa AA seqDB search MKLLVLAVLLTVAAAESGISSRAVWQFRKLIKCVIPGSSPYLEYNNYGCYCGLGGSGTPV DELDKCCQTHDNCYDQAKKLNSCKFLLDNPYTHTYSYSCSNSEITCSSKNKECEAFICNC DRNAAICFSKAPYNKEHKNLDTKKYCQS NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgaaactgcttgtgctggctgtgctgctcacagtggctgccgccgagagcggcatcagc tctcgggccgtgtggcagttccgcaaactgatcaagtgtgtgatcccggggagcagcccc tacttggaatacaacaactacggctgctactgtggcttggggggctcaggcacccccgtg gatgaattggacaagtgctgccagacacatgacaactgctacgaccaggccaagaagcta aacagctgtaaatttctgctggacaacccgtacacccatacctactcatactcgtgctct aactctgagatcacctgcagcagcaaaaacaaagagtgtgaggccttcatttgcaactgc gaccgcaatgctgccatctgcttttcaaaagctccatataacaaggaacacaagaatctg gacaccaagaagtattgtcagagttga

DBGET integrated database retrieval system