Chlorocebus sabaeus (green monkey): 103242323 Help Entry 103242323         CDS       T04361                                  Symbol TP53 Name (RefSeq) tumor protein p53   KO K04451   tumor protein p53 Organism csab  Chlorocebus sabaeus (green monkey) Pathway csab01522   Endocrine resistance csab01524   Platinum drug resistance csab04010   MAPK signaling pathway csab04071   Sphingolipid signaling pathway csab04110   Cell cycle csab04115   p53 signaling pathway csab04137   Mitophagy - animal csab04151   PI3K-Akt signaling pathway csab04210   Apoptosis csab04211   Longevity regulating pathway csab04216   Ferroptosis csab04218   Cellular senescence csab04310   Wnt signaling pathway csab04722   Neurotrophin signaling pathway csab04919   Thyroid hormone signaling pathway csab05012   Parkinson disease csab05014   Amyotrophic lateral sclerosis csab05016   Huntington disease csab05160   Hepatitis C csab05161   Hepatitis B csab05162   Measles csab05163   Human cytomegalovirus infection csab05165   Human papillomavirus infection csab05166   Human T-cell leukemia virus 1 infection csab05167   Kaposi sarcoma-associated herpesvirus infection csab05168   Herpes simplex virus 1 infection csab05169   Epstein-Barr virus infection csab05200   Pathways in cancer csab05202   Transcriptional misregulation in cancer csab05203   Viral carcinogenesis csab05205   Proteoglycans in cancer csab05206   MicroRNAs in cancer csab05210   Colorectal cancer csab05212   Pancreatic cancer csab05213   Endometrial cancer csab05214   Glioma csab05215   Prostate cancer csab05216   Thyroid cancer csab05217   Basal cell carcinoma csab05218   Melanoma csab05219   Bladder cancer csab05220   Chronic myeloid leukemia csab05222   Small cell lung cancer csab05223   Non-small cell lung cancer csab05224   Breast cancer csab05225   Hepatocellular carcinoma csab05226   Gastric cancer csab05230   Central carbon metabolism in cancer csab05417   Lipid and atherosclerosis csab05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:csab00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103242323 (TP53)    04310 Wnt signaling pathway     103242323 (TP53)    04071 Sphingolipid signaling pathway     103242323 (TP53)    04151 PI3K-Akt signaling pathway     103242323 (TP53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     103242323 (TP53)   09143 Cell growth and death    04110 Cell cycle     103242323 (TP53)    04210 Apoptosis     103242323 (TP53)    04216 Ferroptosis     103242323 (TP53)    04115 p53 signaling pathway     103242323 (TP53)    04218 Cellular senescence     103242323 (TP53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     103242323 (TP53)   09156 Nervous system    04722 Neurotrophin signaling pathway     103242323 (TP53)   09149 Aging    04211 Longevity regulating pathway     103242323 (TP53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103242323 (TP53)    05202 Transcriptional misregulation in cancer     103242323 (TP53)    05206 MicroRNAs in cancer     103242323 (TP53)    05205 Proteoglycans in cancer     103242323 (TP53)    05203 Viral carcinogenesis     103242323 (TP53)    05230 Central carbon metabolism in cancer     103242323 (TP53)   09162 Cancer: specific types    05210 Colorectal cancer     103242323 (TP53)    05212 Pancreatic cancer     103242323 (TP53)    05225 Hepatocellular carcinoma     103242323 (TP53)    05226 Gastric cancer     103242323 (TP53)    05214 Glioma     103242323 (TP53)    05216 Thyroid cancer     103242323 (TP53)    05220 Chronic myeloid leukemia     103242323 (TP53)    05217 Basal cell carcinoma     103242323 (TP53)    05218 Melanoma     103242323 (TP53)    05219 Bladder cancer     103242323 (TP53)    05215 Prostate cancer     103242323 (TP53)    05213 Endometrial cancer     103242323 (TP53)    05224 Breast cancer     103242323 (TP53)    05222 Small cell lung cancer     103242323 (TP53)    05223 Non-small cell lung cancer     103242323 (TP53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103242323 (TP53)    05161 Hepatitis B     103242323 (TP53)    05160 Hepatitis C     103242323 (TP53)    05162 Measles     103242323 (TP53)    05168 Herpes simplex virus 1 infection     103242323 (TP53)    05163 Human cytomegalovirus infection     103242323 (TP53)    05167 Kaposi sarcoma-associated herpesvirus infection     103242323 (TP53)    05169 Epstein-Barr virus infection     103242323 (TP53)    05165 Human papillomavirus infection     103242323 (TP53)   09164 Neurodegenerative disease    05012 Parkinson disease     103242323 (TP53)    05014 Amyotrophic lateral sclerosis     103242323 (TP53)    05016 Huntington disease     103242323 (TP53)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103242323 (TP53)    05418 Fluid shear stress and atherosclerosis     103242323 (TP53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     103242323 (TP53)    01522 Endocrine resistance     103242323 (TP53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:csab03000]     103242323 (TP53)    03036 Chromosome and associated proteins [BR:csab03036]     103242323 (TP53)    03400 DNA repair and recombination proteins [BR:csab03400]     103242323 (TP53) Transcription factors [BR:csab03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     103242323 (TP53) Chromosome and associated proteins [BR:csab03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      103242323 (TP53) DNA repair and recombination proteins [BR:csab03400]  Eukaryotic type   Check point factors    Other check point factors     103242323 (TP53) SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer TAD2 Motif Other DBs NCBI-GeneID:  103242323 NCBI-ProteinID:  XP_008008383 Ensembl:  ENSCSAG00000011345 LinkDB All DBs Position 16:complement(7047686..7065567) Genome browser AA seq 411 aa AA seqDB search METVSRSMGGADPLSPPQPQPPSRGLWEAKKIHGTDFLLLSFRLPENNVLSPLPSQAVDD LMLSPDDLAQWLTEDPGPDEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKT YHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAI YKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEP PEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDR RTEEENFRKKGEPCHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFR ELNEALELKDAQAGKEPAGSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt atggaaactgtgagtagatccatgggaggggcagacccactgtccccaccccaaccccag ccccctagcagaggcctgtgggaagcaaaaaaaatccatgggactgactttttgctcttg tctttcagacttcctgaaaacaacgttctgtcccccttgccgtcccaagcggtggatgat ttgatgctatctccggatgatcttgcacaatggttaactgaagacccaggtccagatgaa gctcccagaatgtcagaggctgctccccccatggcccccacaccagcagctcctacaccg gcggcccctgcaccagccccctcctggcccttgtcatcctctgtcccttcccagaaaacc taccacggcagctacggtttccgtctgggcttcctgcattctggaacagccaagtctgtg acttgcacgtactcccctgacctcaacaagatgttttgccagctggccaagacctgcccc gtgcagctgtgggttgattccacacccccgcccggcagccgcgtccgcgccatggccatc tacaagcagtcacagcacatgactgaggtcgtgaggcgctgcccccaccatgagcgctgc tcagacagcgatggactggcccctcctcaacatcttatccgagtggaaggaaatttgcgt gtggagtattcggatgacagaaacacttttcgacatagtgtggtggtgccctatgagccg cctgaggttggctctgactgtaccaccatccactacaactacatgtgtaacagttcctgc atgggcggcatgaaccggaggcccatcctcacaattatcacactggaagactccagtggt aatctactgggacggaacagctttgaggtgcgagtttgtgcctgtcctgggagagaccgg cgcacggaggaagagaatttccgcaagaaaggggagccttgccacgagctgccccctggg agcactaagcgagcactgcccaacaacaccagctcctctccccagccaaagaagaaacca ctggatggagaatatttcacccttcagatccgcgggcgtgagcgcttcgagatgttccga gagctgaatgaggccttggaactcaaggatgcccaggctgggaaagagccagcggggagc agggctcactccagccacctgaagtccaagaaggggcaatctacctcccgccataaaaaa ttcatgttcaagacagaggggcctgactcagactga

DBGET integrated database retrieval system